StarFunc result for job id P08069

User Input

>input (1367 residues)
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6pxvA	0.256	0.411	0.000	823	0.331	0.550	6pxvA.pdb.gz
2	PDB:6pyhD	0.261	0.433	0.000	798	0.561	0.961	6pyhD.pdb.gz
3	AFDB:A0A0R4IGP2	0.760	0.729	0.000	1433	0.675	0.644	A0A0R4IGP2.pdb.gz
4	AFDB:B0R0Q2	0.593	0.588	0.000	1380	0.647	0.641	B0R0Q2.pdb.gz
5	AFDB:F1QNX5	0.687	0.693	0.000	1353	0.582	0.588	F1QNX5.pdb.gz
6	AFDB:O73798	0.672	0.675	0.000	1358	0.748	0.753	O73798.pdb.gz	IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1
7	AFDB:P09208	0.575	0.399	0.000	2144	0.364	0.232	P09208.pdb.gz	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
8	AFDB:P14616	0.648	0.679	0.000	1297	0.532	0.561	P14616.pdb.gz	INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens OX=9606 GN=INSRR PE=1 SV=2
9	AFDB:P15127	0.709	0.701	0.000	1383	0.574	0.567	P15127.pdb.gz	INSR_RAT Insulin receptor OS=Rattus norvegicus OX=10116 GN=Insr PE=1 SV=1
10	AFDB:Q1LVG4	0.773	0.783	0.000	1348	0.571	0.579	Q1LVG4.pdb.gz	Q1LVG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRb PE=1 SV=3
11	AFDB:Q60751	0.932	0.928	0.000	1373	0.959	0.955	Q60751.pdb.gz	IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus OX=10090 GN=Igf1r PE=1 SV=3
12	AFDB:Q64716	0.603	0.630	0.000	1300	0.521	0.548	Q64716.pdb.gz	INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus OX=10116 GN=Insrr PE=1 SV=3
13	PDB:8eyyA	0.338	0.569	1.441E-95	775	0.317	0.559	8eyyA.pdb.gz
14	PDB:8dtlA	0.342	0.595	6.866E-95	741	0.309	0.571	8dtlA.pdb.gz
15	PDB:7bwaA	0.216	0.374	2.993E-71	674	0.285	0.577	7bwaA.pdb.gz
16	PDB:2h8hA	0.178	0.517	1.603E-25	445	0.090	0.276	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
17	PDB:4fl2A	0.183	0.434	2.387E-22	555	0.076	0.187	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
18	PDB:1k9aB	0.182	0.539	2.822E-22	441	0.078	0.240	1k9aB.pdb.gz
19	PDB:4k2rA	0.175	0.421	8.473E-21	551	0.071	0.176	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
20	PDB:7mn8B	0.177	0.376	3.362E-19	579	0.083	0.197	7mn8B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0C4UQS4	985	1454	0.411	0.387	A0A0C4UQS4_NILLU Tyrosine-protein kinase receptor OS=Nilaparvata lugens OX=108931 PE=1 SV=1
2	A0A0C4UR07	774	1427	0.368	0.352	A0A0C4UR07_NILLU Tyrosine-protein kinase receptor OS=Nilaparvata lugens OX=108931 PE=1 SV=1
3	B7SNG4	1601	1353	0.587	0.593	B7SNG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRa PE=1 SV=1
4	G1K218	2802	1367	0.978	0.978	G1K218_BOVIN Tyrosine-protein kinase receptor OS=Bos taurus OX=9913 GN=IGF1R PE=3 SV=3
5	I3PGL2	983	477	0.345	0.990	I3PGL2_BOVIN Tyrosine-protein kinase receptor (Fragment) OS=Bos taurus OX=9913 GN=IGFR1 PE=2 SV=1
6	O73798	2115	1358	0.752	0.757	IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1
7	P06213	1562	1382	0.579	0.572	INSR_HUMAN Insulin receptor OS=Homo sapiens OX=9606 GN=INSR PE=1 SV=4
8	P08069	2851	1367	1.000	1.000	IGF1R_HUMAN Insulin-like growth factor 1 receptor OS=Homo sapiens OX=9606 GN=IGF1R PE=1 SV=1
9	P09208	824	2144	0.382	0.243	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
10	P14616	1458	1297	0.534	0.563	INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens OX=9606 GN=INSRR PE=1 SV=2
11	P15127	1550	1383	0.579	0.573	INSR_RAT Insulin receptor OS=Rattus norvegicus OX=10116 GN=Insr PE=1 SV=1
12	P15208	1563	1372	0.575	0.573	INSR_MOUSE Insulin receptor OS=Mus musculus OX=10090 GN=Insr PE=1 SV=2
13	P24062	2662	1370	0.954	0.952	IGF1R_RAT Insulin-like growth factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Igf1r PE=2 SV=2
14	Q05688	1305	640	0.457	0.977	IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus OX=9913 GN=IGF1R PE=2 SV=1
15	Q1LVG4	1569	1348	0.575	0.583	Q1LVG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRb PE=1 SV=3
16	Q60751	2659	1373	0.955	0.951	IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus OX=10090 GN=Igf1r PE=1 SV=3
17	Q64716	1441	1300	0.522	0.549	INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus OX=10116 GN=Insrr PE=1 SV=3
18	Q9PVZ4	1597	1362	0.580	0.582	INSR_XENLA Insulin receptor OS=Xenopus laevis OX=8355 GN=insr PE=1 SV=1
19	Q9PWN6	1204	989	0.440	0.608	Q9PWN6_CHICK Tyrosine-protein kinase receptor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
20	Q9WTL4	1447	1300	0.528	0.555	INSRR_MOUSE Insulin receptor-related protein OS=Mus musculus OX=10090 GN=Insrr PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14771 DUF4476	6.3e+02	12.1	Domain of unknown function (DUF4476)
2	PF00041 fn3	1.8e-15	68.3	Fibronectin type III domain
3	PF00757 Furin-like	5.5e-35	131.9	Furin-like cysteine rich region
4	PF17870 Insulin_TMD	8.5e+02	11.5	Insulin receptor trans-membrane segment
5	PF14531 Kinase-like	1e+02	13.7	Kinase-like
6	PF00069 Pkinase	8.8e-36	135.2	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	2e-90	314.2	Protein tyrosine and serine/threonine kinase
8	PF01030 Recep_L_domain	1.6e-53	190.9	Receptor L domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268035

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302665	0.999	Insulin-like growth factor I
2	9606.ENSP00000304895	0.999	Insulin receptor substrate 1
3	9606.ENSP00000340944	0.999	Tyrosine-protein phosphatase non-receptor type 11
4	9606.ENSP00000380432	0.999	Insulin
5	9606.ENSP00000391826	0.999	Insulin-like growth factor II
6	9606.ENSP00000401303	0.999	SHC-transforming protein 1
7	9606.ENSP00000405330	0.999	Estrogen receptor
8	9606.ENSP00000426909	0.999	Receptor of activated protein C kinase 1
9	9606.ENSP00000360683	0.998	Tyrosine-protein phosphatase non-receptor type 1
10	9606.ENSP00000365016	0.998	Insulin receptor substrate 2
11	9606.ENSP00000261769	0.997	Cadherin-1
12	9606.ENSP00000381793	0.997	Growth factor receptor-bound protein 10
13	9606.ENSP00000262741	0.996	Phosphatidylinositol 3-kinase regulatory subunit gamma
14	9606.ENSP00000428056	0.991	Phosphatidylinositol 3-kinase regulatory subunit alpha
15	9606.ENSP00000263967	0.989	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
16	9606.ENSP00000344456	0.989	Catenin beta-1
17	9606.ENSP00000258149	0.988	E3 ubiquitin-protein ligase Mdm2
18	9606.ENSP00000346300	0.986	Crk-like protein
19	9606.ENSP00000346839	0.983	Fibronectin type III domain containing
20	9606.ENSP00000052754	0.977	Decorin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005520	0.998	insulin-like growth factor binding
GO:0004714	0.998	transmembrane receptor protein tyrosine kinase activity
GO:0098772	0.832	molecular function regulator activity
GO:0030234	0.727	enzyme regulator activity
GO:0019899	0.653	enzyme binding
GO:0042802	0.558	identical protein binding
GO:0140677	0.508	molecular function activator activity
GO:0030295	0.446	protein kinase activator activity
GO:0030296	0.432	protein tyrosine kinase activator activity
GO:0043539	0.430	protein serine/threonine kinase activator activity
GO:0035014	0.355	phosphatidylinositol 3-kinase regulator activity
GO:0005102	0.316	signaling receptor binding
GO:0044877	0.305	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901700	0.986	response to oxygen-containing compound
GO:0071495	0.986	cellular response to endogenous stimulus
GO:0023051	0.986	regulation of signaling
GO:0010646	0.986	regulation of cell communication
GO:0007166	0.985	cell surface receptor signaling pathway
GO:0071310	0.984	cellular response to organic substance
GO:1901699	0.983	cellular response to nitrogen compound
GO:1901701	0.982	cellular response to oxygen-containing compound
GO:0071704	0.980	organic substance metabolic process
GO:1901652	0.980	response to peptide
GO:0048583	0.979	regulation of response to stimulus
GO:0007167	0.979	enzyme-linked receptor protein signaling pathway
GO:0044238	0.977	primary metabolic process
GO:0048519	0.976	negative regulation of biological process
GO:0044237	0.975	cellular metabolic process
GO:0048518	0.974	positive regulation of biological process
GO:0007169	0.973	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0019222	0.968	regulation of metabolic process
GO:0009966	0.966	regulation of signal transduction
GO:1901653	0.966	cellular response to peptide
GO:0031323	0.963	regulation of cellular metabolic process
GO:0043408	0.961	regulation of MAPK cascade
GO:0071375	0.961	cellular response to peptide hormone stimulus
GO:0048523	0.960	negative regulation of cellular process
GO:0018212	0.959	peptidyl-tyrosine modification
GO:0006468	0.952	protein phosphorylation
GO:0032869	0.947	cellular response to insulin stimulus
GO:0048522	0.946	positive regulation of cellular process
GO:0032501	0.940	multicellular organismal process
GO:0018108	0.940	peptidyl-tyrosine phosphorylation
GO:0048856	0.926	anatomical structure development
GO:0046777	0.924	protein autophosphorylation
GO:0007275	0.902	multicellular organism development
GO:0008286	0.883	insulin receptor signaling pathway
GO:0010604	0.839	positive regulation of macromolecule metabolic process
GO:0051174	0.829	regulation of phosphorus metabolic process
GO:0051171	0.815	regulation of nitrogen compound metabolic process
GO:0080090	0.807	regulation of primary metabolic process
GO:0048731	0.797	system development
GO:0009889	0.794	regulation of biosynthetic process
GO:0042981	0.755	regulation of apoptotic process
GO:0042127	0.750	regulation of cell population proliferation
GO:0031325	0.742	positive regulation of cellular metabolic process
GO:0043410	0.733	positive regulation of MAPK cascade
GO:0051239	0.690	regulation of multicellular organismal process
GO:0080135	0.688	regulation of cellular response to stress
GO:0048513	0.680	animal organ development
GO:0050793	0.679	regulation of developmental process
GO:0051128	0.678	regulation of cellular component organization
GO:0035556	0.642	intracellular signal transduction
GO:0048585	0.640	negative regulation of response to stimulus
GO:0048009	0.612	insulin-like growth factor receptor signaling pathway
GO:0051173	0.611	positive regulation of nitrogen compound metabolic process
GO:0009968	0.608	negative regulation of signal transduction
GO:0031326	0.594	regulation of cellular biosynthetic process
GO:0033500	0.589	carbohydrate homeostasis
GO:0007399	0.538	nervous system development
GO:0010556	0.534	regulation of macromolecule biosynthetic process
GO:0019219	0.510	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.508	regulation of gene expression
GO:0065009	0.503	regulation of molecular function
GO:0071840	0.488	cellular component organization or biogenesis
GO:0009653	0.475	anatomical structure morphogenesis
GO:0048732	0.469	gland development
GO:0051246	0.469	regulation of protein metabolic process
GO:0040012	0.462	regulation of locomotion
GO:0019220	0.457	regulation of phosphate metabolic process
GO:0051252	0.443	regulation of RNA metabolic process
GO:0016043	0.437	cellular component organization
GO:2001141	0.432	regulation of RNA biosynthetic process
GO:0009892	0.423	negative regulation of metabolic process
GO:0007417	0.421	central nervous system development
GO:0010605	0.411	negative regulation of macromolecule metabolic process
GO:0006355	0.411	regulation of DNA-templated transcription
GO:0022414	0.404	reproductive process
GO:0048869	0.372	cellular developmental process
GO:0042593	0.351	glucose homeostasis
GO:0009790	0.342	embryo development
GO:0006950	0.333	response to stress
GO:0030154	0.328	cell differentiation
GO:0009891	0.317	positive regulation of biosynthetic process
GO:0009749	0.314	response to glucose
GO:0031328	0.314	positive regulation of cellular biosynthetic process
GO:0045935	0.306	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.301	positive regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043231	0.901	intracellular membrane-bounded organelle
GO:0005737	0.854	cytoplasm
GO:0005634	0.346	nucleus
GO:0070013	0.341	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.998	receptor protein-tyrosine kinase.

[back to server]