StarFunc result for job id P08138

User Input

>input (427 residues)
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08138	1.000	1.000	2.819E-77	427	1.000	1.000	P08138.pdb.gz	TNR16_HUMAN Tumor necrosis factor receptor superfamily member 16 OS=Homo sapiens OX=9606 GN=NGFR PE=1 SV=1
2	AFDB:P18519	0.557	0.569	3.864E-57	416	0.696	0.714	P18519.pdb.gz	TNR16_CHICK Tumor necrosis factor receptor superfamily member 16 OS=Gallus gallus OX=9031 GN=NGFR PE=2 SV=1
3	AFDB:Q5BJ06	0.460	0.495	3.309E-42	392	0.466	0.508	Q5BJ06.pdb.gz
4	AFDB:F1R841	0.381	0.349	6.815E-42	467	0.471	0.430	F1R841.pdb.gz
5	AFDB:D3ZF92	0.326	0.226	3.365E-18	655	0.262	0.171	D3ZF92.pdb.gz	TNR21_RAT Tumor necrosis factor receptor superfamily member 21 OS=Rattus norvegicus OX=10116 GN=Tnfrsf21 PE=1 SV=1
6	AFDB:A5D8S6	0.310	0.219	2.420E-16	637	0.201	0.135	A5D8S6.pdb.gz	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1
7	AFDB:Q9DFV0	0.176	0.172	3.985E-13	438	0.213	0.208	Q9DFV0.pdb.gz
8	AFDB:Q80WY6	0.283	0.258	4.495E-13	474	0.155	0.139	Q80WY6.pdb.gz	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
9	AFDB:P20333	0.292	0.273	4.774E-13	461	0.157	0.145	P20333.pdb.gz	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
10	AFDB:P25119	0.285	0.261	4.172E-12	474	0.162	0.146	P25119.pdb.gz	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
11	PDB:2rvqD	0.088	0.239	4.531E-1	129	0.054	0.178	2rvqD.pdb.gz
12	PDB:3j9kB	0.143	0.461	6.123E-1	102	0.052	0.216	3j9kB.pdb.gz	Structure of the apoptosome: mechanistic insights into activation of an initiator caspase from Drosophila.
13	PDB:5ekqD	0.090	0.146	6.123E-1	219	0.054	0.105	5ekqD.pdb.gz
14	PDB:6zheC	0.078	0.059	6.907E-1	705	0.044	0.027	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
15	PDB:7dtvA	0.097	0.061	6.907E-1	779	0.061	0.033	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
16	PDB:2hm2Q	0.155	0.589	8.788E-1	89	0.037	0.180	2hm2Q.pdb.gz
17	PDB:6p6cA	0.156	0.535	9.334E-1	90	0.028	0.133	6p6cA.pdb.gz
18	PDB:7c79B	0.065	0.039	9.334E-1	793	0.037	0.020	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
19	PDB:7pj1B	0.077	0.209	1.118	122	0.044	0.156	7pj1B.pdb.gz
20	PDB:5y27A	0.094	0.316	1.511	98	0.037	0.163	5y27A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07174	0.0	754	425	0.918	0.922	TNR16_RAT Tumor necrosis factor receptor superfamily member 16 OS=Rattus norvegicus OX=10116 GN=Ngfr PE=1 SV=1
2	P08138	0.0	868	427	1.000	1.000	TNR16_HUMAN Tumor necrosis factor receptor superfamily member 16 OS=Homo sapiens OX=9606 GN=NGFR PE=1 SV=1
3	P18519	0.0	594	416	0.677	0.695	TNR16_CHICK Tumor necrosis factor receptor superfamily member 16 OS=Gallus gallus OX=9031 GN=NGFR PE=2 SV=1
4	Q9Z0W1	0.0	749	427	0.918	0.918	TNR16_MOUSE Tumor necrosis factor receptor superfamily member 16 OS=Mus musculus OX=10090 GN=Ngfr PE=1 SV=2
5	E2DGP8	8.50e-125	370	431	0.485	0.480	E2DGP8_DANRE Nerve growth factor receptor b OS=Danio rerio OX=7955 GN=ngfrl PE=2 SV=1
6	Q8K5A9	1.24e-28	114	228	0.180	0.338	NRADD_RAT Death domain-containing membrane protein NRADD OS=Rattus norvegicus OX=10116 GN=Nradd PE=1 SV=2
7	Q8CJ26	9.21e-28	112	228	0.173	0.325	NRADD_MOUSE Death domain-containing membrane protein NRADD OS=Mus musculus OX=10090 GN=Nradd PE=1 SV=1
8	O08712	1.91e-11	67.8	401	0.119	0.127	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
9	O00300	1.05e-10	65.5	401	0.117	0.125	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
10	A0A8I6A4J5	1.33e-10	63.9	260	0.173	0.285	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
11	P27512	6.87e-10	62.0	289	0.138	0.204	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
12	Q80WM9	9.71e-10	61.6	275	0.136	0.211	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
13	Q71F55	1.03e-09	61.2	276	0.133	0.207	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
14	O08727	6.05e-09	60.1	401	0.110	0.117	TR11B_RAT Tumor necrosis factor receptor superfamily member 11B OS=Rattus norvegicus OX=10116 GN=Tnfrsf11b PE=2 SV=1
15	A0A8I6AHI1	1.10e-08	58.5	309	0.141	0.194	A0A8I6AHI1_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
16	Q0PKX6	1.48e-08	58.9	436	0.087	0.085	Q0PKX6_DANRE Ovarian TNF receptor OS=Danio rerio OX=7955 GN=otr PE=2 SV=1
17	F6SVZ3	3.04e-08	57.0	269	0.126	0.201	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
18	P19438	2.36e-07	55.1	455	0.126	0.119	TNR1A_HUMAN Tumor necrosis factor receptor superfamily member 1A OS=Homo sapiens OX=9606 GN=TNFRSF1A PE=1 SV=1
19	Q92956	3.72e-07	53.5	283	0.117	0.177	TNR14_HUMAN Tumor necrosis factor receptor superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFRSF14 PE=1 SV=3
20	Q9ER62	4.98e-07	52.4	198	0.094	0.202	TNR22_MOUSE Tumor necrosis factor receptor superfamily member 22 OS=Mus musculus OX=10090 GN=Tnfrsf22 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	1.4e-09	49.3	Death domain
2	PF18422 TNFR_16_TM	3.2e-23	92.9	Tumor necrosis factor receptor member 16 trans-membrane domain
3	PF00020 TNFR_c6	1.6e-20	84.5	TNFR/NGFR cysteine-rich region
4	PF09976 TPR_21	3.1e+02	12.5	Tetratricopeptide repeat-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000172229

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000043402	0.999	Reticulon-4 receptor
2	9606.ENSP00000256637	0.999	Sortilin
3	9606.ENSP00000269321	0.999	Rho GDP-dissociation inhibitor 1
4	9606.ENSP00000277120	0.999	BDNF/NT-3 growth factors receptor
5	9606.ENSP00000347451	0.999	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
6	9606.ENSP00000358525	0.999	Beta-nerve growth factor
7	9606.ENSP00000364847	0.999	Melanoma-associated antigen D1
8	9606.ENSP00000414303	0.999	Brain-derived neurotrophic factor
9	9606.ENSP00000431418	0.999	High affinity nerve growth factor receptor
10	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
11	9606.ENSP00000397297	0.998	Neurotrophin-3
12	9606.ENSP00000220751	0.996	Receptor-interacting serine/threonine-protein kinase 2
13	9606.ENSP00000337838	0.996	Reticulon-4
14	9606.ENSP00000361728	0.996	Protein BEX3
15	9606.ENSP00000469455	0.996	Neurotrophin-4
16	9606.ENSP00000284981	0.994	Amyloid-beta A4 protein
17	9606.ENSP00000400175	0.989	Transforming protein RhoA
18	9606.ENSP00000422185	0.988	Sortilin related VPS10 domain containing receptor 2
19	9606.ENSP00000332643	0.987	Necdin
20	9606.ENSP00000401303	0.986	SHC-transforming protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005035	0.997	death receptor activity
GO:0019899	0.996	enzyme binding
GO:0001540	0.953	amyloid-beta binding
GO:0044389	0.791	ubiquitin-like protein ligase binding
GO:0005516	0.784	calmodulin binding
GO:0031625	0.781	ubiquitin protein ligase binding
GO:0015026	0.759	coreceptor activity
GO:0019838	0.737	growth factor binding
GO:0005102	0.592	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.990	positive regulation of cellular process
GO:0007165	0.986	signal transduction
GO:0048856	0.983	anatomical structure development
GO:0032501	0.972	multicellular organismal process
GO:0019222	0.962	regulation of metabolic process
GO:0048519	0.959	negative regulation of biological process
GO:0048523	0.932	negative regulation of cellular process
GO:0060255	0.914	regulation of macromolecule metabolic process
GO:0010941	0.914	regulation of cell death
GO:0051239	0.909	regulation of multicellular organismal process
GO:0042127	0.905	regulation of cell population proliferation
GO:0042981	0.897	regulation of apoptotic process
GO:0008219	0.895	cell death
GO:0010942	0.895	positive regulation of cell death
GO:0042221	0.890	response to chemical
GO:0048583	0.890	regulation of response to stimulus
GO:0031323	0.890	regulation of cellular metabolic process
GO:0010468	0.888	regulation of gene expression
GO:0048513	0.886	animal organ development
GO:0009605	0.875	response to external stimulus
GO:0070887	0.837	cellular response to chemical stimulus
GO:0051345	0.834	positive regulation of hydrolase activity
GO:0010033	0.830	response to organic substance
GO:0043068	0.830	positive regulation of programmed cell death
GO:0080090	0.820	regulation of primary metabolic process
GO:0051171	0.820	regulation of nitrogen compound metabolic process
GO:0050793	0.805	regulation of developmental process
GO:1902533	0.792	positive regulation of intracellular signal transduction
GO:0007166	0.770	cell surface receptor signaling pathway
GO:0009719	0.769	response to endogenous stimulus
GO:0008284	0.765	positive regulation of cell population proliferation
GO:0030334	0.764	regulation of cell migration
GO:0052547	0.761	regulation of peptidase activity
GO:0010604	0.760	positive regulation of macromolecule metabolic process
GO:0071495	0.754	cellular response to endogenous stimulus
GO:0051247	0.745	positive regulation of protein metabolic process
GO:0006915	0.729	apoptotic process
GO:0052548	0.725	regulation of endopeptidase activity
GO:0019219	0.708	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.702	regulation of cellular biosynthetic process
GO:0051252	0.700	regulation of RNA metabolic process
GO:0035556	0.698	intracellular signal transduction
GO:0031325	0.694	positive regulation of cellular metabolic process
GO:1901701	0.691	cellular response to oxygen-containing compound
GO:0010556	0.680	regulation of macromolecule biosynthetic process
GO:2000146	0.680	negative regulation of cell motility
GO:2000116	0.668	regulation of cysteine-type endopeptidase activity
GO:0050678	0.664	regulation of epithelial cell proliferation
GO:0051254	0.652	positive regulation of RNA metabolic process
GO:2001141	0.651	regulation of RNA biosynthetic process
GO:0010243	0.635	response to organonitrogen compound
GO:0071310	0.625	cellular response to organic substance
GO:0009888	0.596	tissue development
GO:0032879	0.595	regulation of localization
GO:2000026	0.579	regulation of multicellular organismal development
GO:2000630	0.576	positive regulation of miRNA metabolic process
GO:0070997	0.566	neuron death
GO:0006355	0.541	regulation of DNA-templated transcription
GO:0001936	0.513	regulation of endothelial cell proliferation
GO:0008285	0.459	negative regulation of cell population proliferation
GO:0007275	0.451	multicellular organism development
GO:0043065	0.433	positive regulation of apoptotic process
GO:0031328	0.429	positive regulation of cellular biosynthetic process
GO:0010557	0.402	positive regulation of macromolecule biosynthetic process
GO:0006950	0.393	response to stress
GO:0043281	0.390	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045893	0.382	positive regulation of DNA-templated transcription
GO:0071840	0.381	cellular component organization or biogenesis
GO:0048731	0.335	system development
GO:0016043	0.317	cellular component organization
GO:0045862	0.307	positive regulation of proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.983	intracellular anatomical structure
GO:0043226	0.978	organelle
GO:0005737	0.974	cytoplasm
GO:0043227	0.966	membrane-bounded organelle
GO:0043231	0.939	intracellular membrane-bounded organelle
GO:0012505	0.823	endomembrane system
GO:0005576	0.725	extracellular region
GO:0005634	0.687	nucleus
GO:0070013	0.645	intracellular organelle lumen
GO:0031982	0.640	vesicle
GO:0031981	0.609	nuclear lumen
GO:0009986	0.587	cell surface
GO:0005829	0.587	cytosol
GO:0005654	0.542	nucleoplasm
GO:0031410	0.437	cytoplasmic vesicle
GO:0030054	0.435	cell junction
GO:0005768	0.371	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]