StarFunc result for job id P08151

User Input

>input (1106 residues)
MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETN
SCTEGPLFSSPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPAQMNHQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLK
SELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLE
RRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGG
TSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKSL
GCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDARGLQEEPEVGTSMVGSGLNP
YMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETW
GEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEG
PPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCN
YVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHK
SGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLG
GGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGP
PNMAVGNMSVLLRSLPGETEFLNSSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08151	0.999	0.999	0.000	1106	1.000	1.000	P08151.pdb.gz	GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens OX=9606 GN=GLI1 PE=1 SV=1
2	AFDB:P47806	0.268	0.267	0.000	1111	0.858	0.854	P47806.pdb.gz	GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus OX=10090 GN=Gli1 PE=1 SV=4
3	AFDB:F1QAC4	0.192	0.157	4.509E-60	1404	0.462	0.364	F1QAC4.pdb.gz	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
4	AFDB:F1QH64	0.168	0.152	4.348E-49	1225	0.353	0.318	F1QH64.pdb.gz
5	AFDB:P10070	0.151	0.107	5.231E-47	1586	0.424	0.296	P10070.pdb.gz	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
6	AFDB:Q61602	0.158	0.112	1.549E-46	1583	0.372	0.260	Q61602.pdb.gz	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
7	AFDB:Q9IA31	0.166	0.122	9.875E-46	1544	0.362	0.259	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
8	AFDB:F1M2B7	0.155	0.112	1.053E-45	1544	0.386	0.277	F1M2B7.pdb.gz	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3
9	AFDB:P10071	0.162	0.115	1.122E-45	1580	0.363	0.254	P10071.pdb.gz	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
10	AFDB:A0A5K4F1D0	0.149	0.067	1.540E-25	2566	0.227	0.098	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
11	PDB:6lsr0	0.040	0.125	4.983	190	0.022	0.126	6lsr0.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
12	PDB:6cesD	0.028	0.033	6.035	901	0.010	0.012	6cesD.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
13	PDB:3j7aY	0.029	0.108	6.433	154	0.014	0.104	3j7aY.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
14	PDB:7b5lH	0.030	0.051	8.305	423	0.014	0.038	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
15	PDB:3wqyA	0.043	0.050	8.853	905	0.020	0.024	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
16	PDB:4behB	0.024	0.109	8.853	116	0.017	0.164	4behB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QAC4	0.0	669	1404	0.369	0.291	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
2	G3V6X8	0.0	1833	1109	0.861	0.858	G3V6X8_RAT GLI family zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Gli1 PE=3 SV=1
3	P08151	0.0	2228	1106	1.000	1.000	GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens OX=9606 GN=GLI1 PE=1 SV=1
4	P47806	0.0	1815	1111	0.859	0.855	GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus OX=10090 GN=Gli1 PE=1 SV=4
5	P55878	0.0	625	556	0.309	0.615	GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus OX=9031 GN=GLI1 PE=2 SV=1
6	Q800Z9	0.0	672	1404	0.431	0.340	Q800Z9_DANRE Zinc finger transcription factor detour OS=Danio rerio OX=7955 GN=gli1 PE=2 SV=1
7	Q9YGS4	1.32e-152	494	1439	0.310	0.238	Q9YGS4_DANRE Zinc finger protein GLI2 OS=Danio rerio OX=7955 GN=you-too PE=2 SV=2
8	A0A8I6AWR3	7.04e-152	493	1477	0.351	0.263	A0A8I6AWR3_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=1
9	Q5BN24	7.04e-152	490	1363	0.315	0.255	Q5BN24_DANRE GLI family zinc finger 2b OS=Danio rerio OX=7955 GN=gli2b PE=2 SV=2
10	F1M2B7	1.33e-151	493	1544	0.352	0.252	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3
11	Q0VGT2	7.32e-148	483	1544	0.316	0.226	GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus OX=10090 GN=Gli2 PE=1 SV=2
12	Q0VGV1	1.00e-147	483	1540	0.317	0.228	Q0VGV1_MOUSE Gli2 protein OS=Mus musculus OX=10090 GN=Gli2 PE=2 SV=1
13	P10070	1.21e-147	483	1586	0.336	0.235	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
14	Q9IA31	6.20e-143	469	1544	0.307	0.220	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
15	Q61602	5.45e-139	459	1583	0.331	0.231	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
16	F1M9H1	1.35e-136	453	1582	0.331	0.231	F1M9H1_RAT GLI family zinc finger 3 OS=Rattus norvegicus OX=10116 GN=Gli3 PE=3 SV=3
17	P10071	1.99e-136	452	1580	0.316	0.221	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
18	A0A2R8YGX0	2.02e-136	451	1521	0.316	0.229	A0A2R8YGX0_HUMAN GLI family zinc finger 3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=1
19	Q6U6Z9	1.77e-111	382	1553	0.292	0.208	Q6U6Z9_DANRE Transcriptional activator GLI3 OS=Danio rerio OX=7955 GN=im:7142603 PE=2 SV=1
20	P19538	1.15e-83	300	1397	0.130	0.103	CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster OX=7227 GN=ci PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	2.3e-06	39.3	FOXP coiled-coil domain
2	PF06083 IL17	39	16.0	Interleukin-17
3	PF00096 zf-C2H2	6.2e-16	69.0	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	0.0046	28.7	C2H2-type zinc finger
5	PF13465 zf-H2C2_2	1.7e-07	42.6	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228682

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358918	0.999	Suppressor of fused homolog
2	9606.ENSP00000295709	0.996	Serine/threonine-protein kinase 36
3	9606.ENSP00000249373	0.994	Smoothened homolog
4	9606.ENSP00000297261	0.994	Sonic hedgehog protein
5	9606.ENSP00000359206	0.986	F-box/WD repeat-containing protein 1A
6	9606.ENSP00000377934	0.982	Kinesin-like protein KIF7
7	9606.ENSP00000481842	0.981	Histone deacetylase complex subunit SAP18
8	9606.ENSP00000332353	0.980	Protein patched homolog 1
9	9606.ENSP00000377001	0.976	Speckle-type POZ protein
10	9606.ENSP00000362649	0.975	Histone deacetylase 1
11	9606.ENSP00000323580	0.964	Intraflagellar transport protein 88 homolog
12	9606.ENSP00000361266	0.963	Protein patched homolog 2
13	9606.ENSP00000400312	0.963	Serine/threonine-protein kinase ULK3
14	9606.ENSP00000344456	0.962	Catenin beta-1
15	9606.ENSP00000385808	0.962	Kinesin-like protein KIF3A
16	9606.ENSP00000322804	0.961	Metastasis suppressor protein 1
17	9606.ENSP00000430432	0.961	Histone deacetylase 2
18	9606.ENSP00000260570	0.954	Intraflagellar transport protein 172 homolog
19	9606.ENSP00000280098	0.952	Speckle-type POZ protein-like
20	9606.ENSP00000390436	0.950	Zinc finger protein GLI2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042802	0.330	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048856	0.970	anatomical structure development
GO:0048518	0.969	positive regulation of biological process
GO:0032501	0.968	multicellular organismal process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0080090	0.947	regulation of primary metabolic process
GO:0051171	0.941	regulation of nitrogen compound metabolic process
GO:0007275	0.940	multicellular organism development
GO:0048513	0.939	animal organ development
GO:0050896	0.934	response to stimulus
GO:0031323	0.933	regulation of cellular metabolic process
GO:0048522	0.929	positive regulation of cellular process
GO:0010468	0.921	regulation of gene expression
GO:0010604	0.906	positive regulation of macromolecule metabolic process
GO:0019219	0.895	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.891	regulation of RNA metabolic process
GO:0010556	0.885	regulation of macromolecule biosynthetic process
GO:0031326	0.885	regulation of cellular biosynthetic process
GO:0006355	0.883	regulation of DNA-templated transcription
GO:0051716	0.873	cellular response to stimulus
GO:0048731	0.871	system development
GO:0051173	0.860	positive regulation of nitrogen compound metabolic process
GO:0031325	0.849	positive regulation of cellular metabolic process
GO:0006357	0.841	regulation of transcription by RNA polymerase II
GO:0007165	0.829	signal transduction
GO:0045935	0.828	positive regulation of nucleobase-containing compound metabolic process
GO:0048519	0.827	negative regulation of biological process
GO:0048869	0.781	cellular developmental process
GO:0048523	0.758	negative regulation of cellular process
GO:0031328	0.741	positive regulation of cellular biosynthetic process
GO:0010557	0.739	positive regulation of macromolecule biosynthetic process
GO:0045893	0.731	positive regulation of DNA-templated transcription
GO:0045944	0.673	positive regulation of transcription by RNA polymerase II
GO:0007166	0.667	cell surface receptor signaling pathway
GO:0048583	0.643	regulation of response to stimulus
GO:0030154	0.618	cell differentiation
GO:0010646	0.615	regulation of cell communication
GO:0023051	0.613	regulation of signaling
GO:0009653	0.601	anatomical structure morphogenesis
GO:0009966	0.589	regulation of signal transduction
GO:0050793	0.550	regulation of developmental process
GO:0048732	0.438	gland development
GO:0009892	0.428	negative regulation of metabolic process
GO:0042127	0.408	regulation of cell population proliferation
GO:0010605	0.385	negative regulation of macromolecule metabolic process
GO:0008152	0.347	metabolic process
GO:0051172	0.323	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.997	cytoplasm
GO:0070013	0.985	intracellular organelle lumen
GO:0005654	0.983	nucleoplasm
GO:0042995	0.977	cell projection
GO:0005829	0.972	cytosol
GO:0032991	0.969	protein-containing complex
GO:0120025	0.959	plasma membrane bounded cell projection
GO:0043232	0.915	intracellular non-membrane-bounded organelle
GO:0005929	0.665	cilium
GO:1990788	0.385	GLI-SUFU complex
GO:0097546	0.319	ciliary base

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]