StarFunc result for job id P08172

User Input

>input (466 residues)
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A5F7ZKY2	0.781	0.743	1.074E-49	492	0.985	0.933	A0A5F7ZKY2.pdb.gz	A0A5F7ZKY2_MACMU Muscarinic acetylcholine receptor OS=Macaca mulatta OX=9544 GN=CHRM2 PE=3 SV=1
2	AFDB:B3DKN8	0.708	0.668	6.366E-39	495	0.723	0.681	B3DKN8.pdb.gz	B3DKN8_DANRE Muscarinic acetylcholine receptor OS=Danio rerio OX=7955 GN=chrm2 PE=2 SV=1
3	AFDB:P08173	0.659	0.641	7.753E-35	479	0.582	0.566	P08173.pdb.gz	ACM4_HUMAN Muscarinic acetylcholine receptor M4 OS=Homo sapiens OX=9606 GN=CHRM4 PE=1 SV=2
4	AFDB:P04761	0.632	0.640	1.020E-28	460	0.444	0.450	P04761.pdb.gz	ACM1_PIG Muscarinic acetylcholine receptor M1 OS=Sus scrofa OX=9823 GN=CHRM1 PE=2 SV=1
5	AFDB:A0A024R3W1	0.600	0.478	5.069E-28	590	0.479	0.378	A0A024R3W1.pdb.gz
6	AFDB:Q920H4	0.619	0.543	5.287E-28	532	0.468	0.410	Q920H4.pdb.gz	ACM5_MOUSE Muscarinic acetylcholine receptor M5 OS=Mus musculus OX=10090 GN=Chrm5 PE=2 SV=2
7	AFDB:X1WHZ7	0.634	0.501	1.083E-27	595	0.455	0.356	X1WHZ7.pdb.gz
8	AFDB:P08912	0.612	0.537	1.229E-27	532	0.457	0.400	P08912.pdb.gz	ACM5_HUMAN Muscarinic acetylcholine receptor M5 OS=Homo sapiens OX=9606 GN=CHRM5 PE=1 SV=2
9	PDB:3uonA	0.586	0.623	4.917E-27	438	0.622	0.662	3uonA.pdb.gz	Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist.
10	AFDB:P16395	0.620	0.366	1.162E-23	805	0.431	0.250	P16395.pdb.gz	ACM1_DROME Muscarinic acetylcholine receptor DM1 OS=Drosophila melanogaster OX=7227 GN=mAChR-A PE=2 SV=2
11	PDB:6zfzA	0.597	0.623	1.951E-22	446	0.423	0.442	6zfzA.pdb.gz	From structure to clinic: Design of a muscarinic M1 receptor agonist with potential to treatment of Alzheimer's disease.
12	AFDB:Q9U7D5	0.625	0.483	1.487E-21	611	0.397	0.303	Q9U7D5.pdb.gz	ACM3_CAEEL Muscarinic acetylcholine receptor gar-3 OS=Caenorhabditis elegans OX=6239 GN=gar-3 PE=1 SV=2
13	PDB:6u1nR	0.530	0.867	2.558E-21	278	0.564	0.946	6u1nR.pdb.gz	Structure of the M2 muscarinic receptor-beta-arrestin complex in a lipid nanodisc.
14	PDB:4u14A	0.569	0.607	2.668E-21	436	0.431	0.461	4u14A.pdb.gz	Modified T4 Lysozyme Fusion Proteins Facilitate G Protein-Coupled Receptor Crystallogenesis.
15	PDB:7f61A	0.574	0.871	1.702E-13	301	0.195	0.302	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
16	PDB:7e32R	0.526	0.840	3.342E-13	285	0.208	0.340	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
17	PDB:6iblA	0.534	0.622	1.885E-12	397	0.191	0.224	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
18	PDB:7jvqR	0.517	0.817	1.553E-11	286	0.204	0.332	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
19	PDB:6g79S	0.523	0.904	2.271E-11	262	0.206	0.366	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
20	PDB:7xt8R	0.510	0.783	2.271E-11	294	0.195	0.310	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5F7ZKY2	0.0	957	492	0.994	0.941	A0A5F7ZKY2_MACMU Muscarinic acetylcholine receptor OS=Macaca mulatta OX=9544 GN=CHRM2 PE=3 SV=1
2	B3DKN8	0.0	622	495	0.719	0.677	B3DKN8_DANRE Muscarinic acetylcholine receptor OS=Danio rerio OX=7955 GN=chrm2 PE=2 SV=1
3	P08172	0.0	962	466	1.000	1.000	ACM2_HUMAN Muscarinic acetylcholine receptor M2 OS=Homo sapiens OX=9606 GN=CHRM2 PE=1 SV=1
4	P08173	0.0	533	479	0.597	0.580	ACM4_HUMAN Muscarinic acetylcholine receptor M4 OS=Homo sapiens OX=9606 GN=CHRM4 PE=1 SV=2
5	P08485	0.0	531	478	0.597	0.582	ACM4_RAT Muscarinic acetylcholine receptor M4 OS=Rattus norvegicus OX=10116 GN=Chrm4 PE=1 SV=1
6	P10980	0.0	885	466	0.942	0.942	ACM2_RAT Muscarinic acetylcholine receptor M2 OS=Rattus norvegicus OX=10116 GN=Chrm2 PE=1 SV=2
7	P32211	0.0	533	479	0.597	0.580	ACM4_MOUSE Muscarinic acetylcholine receptor M4 OS=Mus musculus OX=10090 GN=Chrm4 PE=2 SV=1
8	Q801M4	0.0	619	495	0.715	0.673	Q801M4_DANRE Muscarinic acetylcholine receptor OS=Danio rerio OX=7955 GN=chrm2 PE=3 SV=1
9	Q9ERZ4	0.0	885	466	0.942	0.942	ACM2_MOUSE Muscarinic acetylcholine receptor M2 OS=Mus musculus OX=10090 GN=Chrm2 PE=1 SV=2
10	P20309	2.74e-139	414	590	0.479	0.378	ACM3_HUMAN Muscarinic acetylcholine receptor M3 OS=Homo sapiens OX=9606 GN=CHRM3 PE=1 SV=1
11	P08483	1.94e-136	407	589	0.485	0.384	ACM3_RAT Muscarinic acetylcholine receptor M3 OS=Rattus norvegicus OX=10116 GN=Chrm3 PE=1 SV=1
12	Q9ERZ3	1.38e-135	404	589	0.470	0.372	ACM3_MOUSE Muscarinic acetylcholine receptor M3 OS=Mus musculus OX=10090 GN=Chrm3 PE=1 SV=1
13	P08911	1.08e-132	395	531	0.485	0.426	ACM5_RAT Muscarinic acetylcholine receptor M5 OS=Rattus norvegicus OX=10116 GN=Chrm5 PE=1 SV=1
14	P04761	8.89e-132	390	460	0.436	0.441	ACM1_PIG Muscarinic acetylcholine receptor M1 OS=Sus scrofa OX=9823 GN=CHRM1 PE=2 SV=1
15	P08482	2.07e-131	389	460	0.436	0.441	ACM1_RAT Muscarinic acetylcholine receptor M1 OS=Rattus norvegicus OX=10116 GN=Chrm1 PE=1 SV=1
16	P11229	5.39e-131	388	460	0.433	0.439	ACM1_HUMAN Muscarinic acetylcholine receptor M1 OS=Homo sapiens OX=9606 GN=CHRM1 PE=1 SV=2
17	P12657	9.69e-131	388	460	0.433	0.439	ACM1_MOUSE Muscarinic acetylcholine receptor M1 OS=Mus musculus OX=10090 GN=Chrm1 PE=1 SV=2
18	Q920H4	2.71e-129	387	532	0.481	0.421	ACM5_MOUSE Muscarinic acetylcholine receptor M5 OS=Mus musculus OX=10090 GN=Chrm5 PE=2 SV=2
19	P08912	4.41e-129	386	532	0.470	0.412	ACM5_HUMAN Muscarinic acetylcholine receptor M5 OS=Homo sapiens OX=9606 GN=CHRM5 PE=1 SV=2
20	P16395	2.10e-75	254	805	0.258	0.149	ACM1_DROME Muscarinic acetylcholine receptor DM1 OS=Drosophila melanogaster OX=7227 GN=mAChR-A PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.2e-67	239.6	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	1.8	19.9	Olfactory receptor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399745

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000409581	0.926	Beta-arrestin-1
2	9606.ENSP00000261837	0.902	Guanine nucleotide-binding protein subunit beta-5
3	9606.ENSP00000345195	0.900	Ubiquilin-2
4	9606.ENSP00000334448	0.897	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
5	9606.ENSP00000481878	0.868	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
6	9606.ENSP00000248564	0.835	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
7	9606.ENSP00000360021	0.831	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
8	9606.ENSP00000232564	0.830	Guanine nucleotide-binding protein subunit beta-4
9	9606.ENSP00000321326	0.829	Proteinase-activated receptor 1
10	9606.ENSP00000363411	0.823	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
11	9606.ENSP00000371594	0.822	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
12	9606.ENSP00000229264	0.818	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
13	9606.ENSP00000363553	0.817	Lysophosphatidic acid receptor 1
14	9606.ENSP00000248150	0.816	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
15	9606.ENSP00000306490	0.815	Muscarinic acetylcholine receptor M1
16	9606.ENSP00000248572	0.808	Guanine nucleotide-binding protein G(T) subunit gamma-T1
17	9606.ENSP00000300873	0.808	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8
18	9606.ENSP00000305260	0.806	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
19	9606.ENSP00000367691	0.806	Lysophosphatidic acid receptor 6
20	9606.ENSP00000294117	0.804	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016907	1.000	G protein-coupled acetylcholine receptor activity
GO:0005488	0.992	binding
GO:0005515	0.984	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010243	0.995	response to organonitrogen compound
GO:0007165	0.995	signal transduction
GO:0007267	0.991	cell-cell signaling
GO:1901700	0.990	response to oxygen-containing compound
GO:0099536	0.981	synaptic signaling
GO:0007186	0.981	G protein-coupled receptor signaling pathway
GO:0095500	0.967	acetylcholine receptor signaling pathway
GO:0051239	0.595	regulation of multicellular organismal process
GO:0032501	0.550	multicellular organismal process
GO:0044057	0.541	regulation of system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.723	organelle
GO:0005622	0.667	intracellular anatomical structure
GO:0030054	0.621	cell junction
GO:0005737	0.617	cytoplasm
GO:0045202	0.584	synapse
GO:0043227	0.432	membrane-bounded organelle
GO:0043229	0.414	intracellular organelle
GO:0012505	0.409	endomembrane system
GO:0031982	0.352	vesicle
GO:0098590	0.327	plasma membrane region
GO:0043231	0.323	intracellular membrane-bounded organelle
GO:0031090	0.313	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]