StarFunc result for job id P08174

User Input

>input (381 residues)
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTV
ITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFP
VGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI
LFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGER
DHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLS
GHTCFTLTGLLGTLVTMGLLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08174	1.000	1.000	2.013E-64	381	1.000	1.000	P08174.pdb.gz	DAF_HUMAN Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55 PE=1 SV=4
2	AFDB:Q61475	0.647	0.633	3.572E-39	390	0.451	0.441	Q61475.pdb.gz	DAF1_MOUSE Complement decay-accelerating factor, GPI-anchored OS=Mus musculus OX=10090 GN=Cd55 PE=1 SV=2
3	AFDB:Q9Z0L9	0.639	0.528	1.220E-37	466	0.444	0.363	Q9Z0L9.pdb.gz	Q9Z0L9_RAT Decay accelarating factor 1, isoform CRA_c OS=Rattus norvegicus OX=10116 GN=Cd55 PE=2 SV=1
4	AFDB:Q9GLM1	0.490	0.568	1.843E-30	326	0.449	0.525	Q9GLM1.pdb.gz	Q9GLM1_PIG Decay-accelerating factor CD55 OS=Sus scrofa OX=9823 PE=2 SV=1
5	AFDB:Q9GLM0	0.484	0.374	5.688E-28	498	0.407	0.311	Q9GLM0.pdb.gz	Q9GLM0_PIG Decay-accelerating factor CD55 OS=Sus scrofa OX=9823 PE=2 SV=1
6	AFDB:P17927	0.427	0.088	4.889E-23	2039	0.244	0.046	P17927.pdb.gz	CR1_HUMAN Complement receptor type 1 OS=Homo sapiens OX=9606 GN=CR1 PE=1 SV=3
7	AFDB:Q2VPA4	0.326	0.221	6.317E-22	569	0.223	0.149	Q2VPA4.pdb.gz	CR1L_HUMAN Complement component receptor 1-like protein OS=Homo sapiens OX=9606 GN=CR1L PE=1 SV=3
8	AFDB:O08569	0.415	0.300	8.163E-21	533	0.244	0.174	O08569.pdb.gz	ZP3R_CAVPO Zona pellucida sperm-binding protein 3 receptor OS=Cavia porcellus OX=10141 GN=ZP3R PE=1 SV=1
9	AFDB:P04003	0.455	0.295	7.004E-20	597	0.202	0.129	P04003.pdb.gz	C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sapiens OX=9606 GN=C4BPA PE=1 SV=2
10	AFDB:Q7TSY4	0.439	0.297	1.110E-19	577	0.205	0.135	Q7TSY4.pdb.gz	ZP3R_RAT Zona pellucida sperm-binding protein 3 receptor OS=Rattus norvegicus OX=10116 GN=Zp3r PE=2 SV=1
11	PDB:2q7zA	0.200	0.074	5.123E-18	1931	0.207	0.041	2q7zA.pdb.gz
12	PDB:2gsxA	0.296	0.143	1.223E-16	951	0.202	0.081	2gsxA.pdb.gz
13	PDB:1c1zA	0.285	0.310	5.680E-16	326	0.165	0.193	1c1zA.pdb.gz
14	PDB:1haqA	0.223	0.103	4.187E-11	1213	0.184	0.058	1haqA.pdb.gz
15	PDB:8a7eC	0.242	0.078	1.052E-9	1524	0.150	0.037	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:2xwbF	0.176	0.102	1.359E-9	714	0.136	0.073	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
17	PDB:8a7dQ	0.177	0.226	1.756E-9	273	0.113	0.158	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
18	PDB:4e0sB	0.168	0.080	3.788E-6	898	0.123	0.052	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
19	PDB:3t5oA	0.226	0.112	3.987E-6	871	0.108	0.047	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
20	PDB:7nycC	0.230	0.125	4.893E-6	809	0.102	0.048	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08174	0.0	776	381	1.000	1.000	DAF_HUMAN Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55 PE=1 SV=4
2	Q61475	1.77e-118	350	390	0.467	0.456	DAF1_MOUSE Complement decay-accelerating factor, GPI-anchored OS=Mus musculus OX=10090 GN=Cd55 PE=1 SV=2
3	Q9Z0M0	1.97e-113	338	399	0.441	0.421	Q9Z0M0_RAT CD55 molecule (Cromer blood group) OS=Rattus norvegicus OX=10116 GN=Cd55 PE=1 SV=1
4	A0A8I5ZMB7	1.28e-109	329	422	0.433	0.391	A0A8I5ZMB7_RAT CD55 molecule (Cromer blood group) OS=Rattus norvegicus OX=10116 GN=Cd55 PE=4 SV=1
5	Q9Z0L9	1.39e-106	323	466	0.415	0.339	Q9Z0L9_RAT Decay accelarating factor 1, isoform CRA_c OS=Rattus norvegicus OX=10116 GN=Cd55 PE=2 SV=1
6	A0A8I5XWT0	4.02e-104	325	773	0.396	0.195	A0A8I5XWT0_RAT CD55 molecule (Cromer blood group) OS=Rattus norvegicus OX=10116 GN=Cd55 PE=1 SV=1
7	Q9GLM1	3.26e-103	309	326	0.441	0.515	Q9GLM1_PIG Decay-accelerating factor CD55 OS=Sus scrofa OX=9823 PE=2 SV=1
8	Q9GLM0	3.62e-92	287	498	0.399	0.305	Q9GLM0_PIG Decay-accelerating factor CD55 OS=Sus scrofa OX=9823 PE=2 SV=1
9	Q9GLM2	5.76e-90	276	341	0.325	0.364	Q9GLM2_PIG Decay-accelerating factor CD55 OS=Sus scrofa OX=9823 GN=CD55 PE=2 SV=1
10	Q9DEG0	4.78e-45	162	451	0.218	0.184	Q9DEG0_CHICK Complement regulatory membrane protein OS=Gallus gallus OX=9031 GN=Cremp PE=2 SV=1
11	P17927	6.56e-40	153	2039	0.265	0.050	CR1_HUMAN Complement receptor type 1 OS=Homo sapiens OX=9606 GN=CR1 PE=1 SV=3
12	Q63514	1.11e-39	150	558	0.215	0.147	C4BPA_RAT C4b-binding protein alpha chain OS=Rattus norvegicus OX=10116 GN=C4bpa PE=2 SV=1
13	D3Z9F7	5.04e-39	150	1406	0.205	0.055	D3Z9F7_RAT Complement C3d receptor 2 OS=Rattus norvegicus OX=10116 GN=Cr2 PE=4 SV=3
14	Q64735	6.58e-38	144	483	0.220	0.174	CR1L_MOUSE Complement component receptor 1-like protein OS=Mus musculus OX=10090 GN=Cr1l PE=1 SV=1
15	Q2VPA4	9.36e-38	145	569	0.234	0.156	CR1L_HUMAN Complement component receptor 1-like protein OS=Homo sapiens OX=9606 GN=CR1L PE=1 SV=3
16	P04003	6.11e-37	143	597	0.205	0.131	C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sapiens OX=9606 GN=C4BPA PE=1 SV=2
17	Q63135	1.83e-36	141	559	0.210	0.143	CR1L_RAT Complement component receptor 1-like protein OS=Rattus norvegicus OX=10116 GN=Cr1l PE=1 SV=1
18	O08569	2.51e-36	140	533	0.205	0.146	ZP3R_CAVPO Zona pellucida sperm-binding protein 3 receptor OS=Cavia porcellus OX=10141 GN=ZP3R PE=1 SV=1
19	Q7TSY4	8.50e-35	137	577	0.194	0.128	ZP3R_RAT Zona pellucida sperm-binding protein 3 receptor OS=Rattus norvegicus OX=10116 GN=Zp3r PE=2 SV=1
20	Q60736	9.82e-35	136	579	0.192	0.126	ZP3R_MOUSE Zona pellucida sperm-binding protein 3 receptor OS=Mus musculus OX=10090 GN=Zp3r PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00084 Sushi	8.2e-39	143.2	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000056033

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000017648	0.912	Uncharacterized protein
2	9598.ENSPTRP00000048961	0.864	Uncharacterized protein
3	9598.ENSPTRP00000006057	0.857	CD59 molecule, complement regulatory protein
4	9598.ENSPTRP00000018085	0.806	Uncharacterized protein
5	9598.ENSPTRP00000028112	0.695	Pro-epidermal growth factor
6	9598.ENSPTRP00000037149	0.694	Phosphatidylinositol glycan anchor biosynthesis, class A
7	9598.ENSPTRP00000050338	0.665	Uncharacterized protein
8	9598.ENSPTRP00000054478	0.665	Uncharacterized protein
9	9598.ENSPTRP00000054722	0.662	Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5 (By similarity)
10	9598.ENSPTRP00000007901	0.650	Uncharacterized protein
11	9598.ENSPTRP00000018082	0.611	Uncharacterized protein
12	9598.ENSPTRP00000021822	0.607	Post-GPI attachment to proteins 1
13	9598.ENSPTRP00000037513	0.598	Uncharacterized protein
14	9598.ENSPTRP00000017658	0.577	Uncharacterized protein
15	9598.ENSPTRP00000054792	0.551	C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system
16	9598.ENSPTRP00000010959	0.550	Membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)
17	9598.ENSPTRP00000054387	0.545	C5a anaphylatoxin chemotactic receptor 1
18	9598.ENSPTRP00000023770	0.523	CXADR, Ig-like cell adhesion molecule
19	9598.ENSPTRP00000022833	0.513	Thrombomodulin
20	9598.ENSPTRP00000036418	0.508	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	1.000	lipid binding
GO:0005515	1.000	protein binding
GO:0001618	1.000	virus receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0050789	0.977	regulation of biological process
GO:0002682	0.945	regulation of immune system process
GO:0048583	0.936	regulation of response to stimulus
GO:0050776	0.932	regulation of immune response
GO:0050794	0.921	regulation of cellular process
GO:0048518	0.905	positive regulation of biological process
GO:0031341	0.894	regulation of cell killing
GO:0030449	0.836	regulation of complement activation
GO:0048519	0.834	negative regulation of biological process
GO:0050778	0.820	positive regulation of immune response
GO:1903037	0.795	regulation of leukocyte cell-cell adhesion
GO:0022409	0.795	positive regulation of cell-cell adhesion
GO:0051251	0.782	positive regulation of lymphocyte activation
GO:0050863	0.769	regulation of T cell activation
GO:0001817	0.740	regulation of cytokine production
GO:0050670	0.731	regulation of lymphocyte proliferation
GO:0010628	0.710	positive regulation of gene expression
GO:0032101	0.703	regulation of response to external stimulus
GO:0008284	0.697	positive regulation of cell population proliferation
GO:1903039	0.692	positive regulation of leukocyte cell-cell adhesion
GO:0002683	0.685	negative regulation of immune system process
GO:0009987	0.645	cellular process
GO:0050870	0.645	positive regulation of T cell activation
GO:0050777	0.627	negative regulation of immune response
GO:0002698	0.625	negative regulation of immune effector process
GO:0002699	0.615	positive regulation of immune effector process
GO:0002705	0.603	positive regulation of leukocyte mediated immunity
GO:0009966	0.601	regulation of signal transduction
GO:0002824	0.586	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0042129	0.584	regulation of T cell proliferation
GO:0002708	0.581	positive regulation of lymphocyte mediated immunity
GO:0002921	0.571	negative regulation of humoral immune response
GO:0002709	0.559	regulation of T cell mediated immunity
GO:0032946	0.555	positive regulation of mononuclear cell proliferation
GO:0002700	0.554	regulation of production of molecular mediator of immune response
GO:0050671	0.531	positive regulation of lymphocyte proliferation
GO:0050896	0.528	response to stimulus
GO:0042102	0.494	positive regulation of T cell proliferation
GO:0002702	0.491	positive regulation of production of molecular mediator of immune response
GO:0001819	0.471	positive regulation of cytokine production
GO:0046634	0.456	regulation of alpha-beta T cell activation
GO:0002711	0.449	positive regulation of T cell mediated immunity
GO:2000514	0.426	regulation of CD4-positive, alpha-beta T cell activation
GO:0065008	0.407	regulation of biological quality
GO:0046640	0.404	regulation of alpha-beta T cell proliferation
GO:0046635	0.402	positive regulation of alpha-beta T cell activation
GO:0032501	0.314	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005576	0.996	extracellular region
GO:0005737	0.996	cytoplasm
GO:0005886	0.995	plasma membrane
GO:0043229	0.994	intracellular organelle
GO:0012505	0.991	endomembrane system
GO:0031982	0.984	vesicle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005615	0.979	extracellular space
GO:0070062	0.967	extracellular exosome
GO:0030141	0.966	secretory granule
GO:0031090	0.957	organelle membrane
GO:0098588	0.954	bounding membrane of organelle
GO:0012506	0.922	vesicle membrane
GO:0009986	0.791	cell surface
GO:0005794	0.785	Golgi apparatus
GO:0030659	0.781	cytoplasmic vesicle membrane
GO:0032991	0.740	protein-containing complex
GO:0030667	0.682	secretory granule membrane
GO:0070820	0.552	tertiary granule
GO:0098857	0.543	membrane microdomain
GO:0005793	0.524	endoplasmic reticulum-Golgi intermediate compartment
GO:0101002	0.512	ficolin-1-rich granule
GO:0000139	0.461	Golgi membrane
GO:0101003	0.441	ficolin-1-rich granule membrane
GO:0030133	0.357	transport vesicle
GO:0070013	0.346	intracellular organelle lumen
GO:0033116	0.345	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0070821	0.344	tertiary granule membrane
GO:0045121	0.337	membrane raft

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]