StarFunc result for job id P08183

User Input

>input (1280 residues)
MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4m1mA	0.912	0.982	0.000	1188	0.824	0.888	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
2	PDB:6qexA	0.829	0.893	0.000	1182	0.920	0.997	6qexA.pdb.gz	Structural insight into substrate and inhibitor discrimination by human P-glycoprotein.
3	PDB:7niwA	0.788	0.877	0.000	1140	0.716	0.804	7niwA.pdb.gz	Structures of ABCB4 provide insight into phosphatidylcholine translocation.
4	AFDB:A0A2R8QDG3	0.942	0.894	0.000	1350	0.578	0.548	A0A2R8QDG3.pdb.gz
5	AFDB:A4D1D2	0.979	0.979	0.000	1280	1.000	1.000	A4D1D2.pdb.gz	A4D1D2_HUMAN ATP-binding cassette, sub-family B (MDR/TAP), member 1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=2 SV=1
6	AFDB:B5X0E4	0.917	0.935	0.000	1255	0.519	0.529	B5X0E4.pdb.gz	ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus OX=10090 GN=Abcb5 PE=2 SV=1
7	AFDB:B8K1W2	0.913	0.882	0.000	1325	0.504	0.487	B8K1W2.pdb.gz	ABCBB_CANLF Bile salt export pump OS=Canis lupus familiaris OX=9615 GN=Abcb11e PE=1 SV=1
8	AFDB:E7EZD3	0.895	0.876	0.000	1308	0.518	0.507	E7EZD3.pdb.gz
9	AFDB:E7F1E3	0.932	0.935	0.000	1275	0.637	0.640	E7F1E3.pdb.gz	E7F1E3_DANRE ATP-binding cassette, sub-family B (MDR/TAP), member 4 OS=Danio rerio OX=7955 GN=zgc:172149 PE=4 SV=1
10	AFDB:G5EDF9	0.911	0.917	0.000	1272	0.449	0.452	G5EDF9.pdb.gz	G5EDF9_CAEEL ABC transporter PGP-2 OS=Caenorhabditis elegans OX=6239 GN=pgp-2 PE=1 SV=1
11	AFDB:O70127	0.922	0.894	0.000	1321	0.495	0.479	O70127.pdb.gz	ABCBB_RAT Bile salt export pump OS=Rattus norvegicus OX=10116 GN=Abcb11 PE=1 SV=1
12	AFDB:O80725	0.909	0.905	0.000	1286	0.413	0.411	O80725.pdb.gz	AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCB4 PE=1 SV=1
13	AFDB:O95342	0.923	0.895	0.000	1321	0.510	0.494	O95342.pdb.gz	ABCBB_HUMAN Bile salt export pump OS=Homo sapiens OX=9606 GN=ABCB11 PE=1 SV=2
14	PDB:4f4cA	0.741	0.756	4.905E-103	1250	0.439	0.450	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
15	PDB:6lr0U	0.830	0.862	3.754E-99	1230	0.504	0.524	6lr0U.pdb.gz
16	PDB:7dv5U	0.862	0.926	7.562E-96	1189	0.501	0.539	7dv5U.pdb.gz	Structures of human bile acid exporter ABCB11 reveal a transport mechanism facilitated by two tandem substrate-binding pockets.
17	PDB:7vluA	0.559	0.603	2.115E-50	1159	0.181	0.200	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
18	PDB:7s5xE	0.587	0.543	7.110E-49	1412	0.180	0.164	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
19	PDB:7mpeA	0.661	0.601	1.619E-46	1428	0.191	0.172	7mpeA.pdb.gz
20	PDB:6c3pE	0.578	0.551	5.382E-46	1359	0.170	0.160	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y6F1	1227	721	0.473	0.840	A0A8I5Y6F1_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
2	A0A8I5ZY39	2187	1248	0.841	0.862	A0A8I5ZY39_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
3	A0A8I6GMN6	2197	1243	0.842	0.867	A0A8I6GMN6_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
4	A0MH69	1248	1336	0.523	0.501	A0MH69_ONCMY Bile salt export pump OS=Oncorhynchus mykiss OX=8022 GN=Abcb11 PE=2 SV=2
5	A4D1D2	2627	1280	1.000	1.000	A4D1D2_HUMAN ATP-binding cassette, sub-family B (MDR/TAP), member 1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=2 SV=1
6	B5X0E4	1390	1255	0.516	0.527	ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus OX=10090 GN=Abcb5 PE=2 SV=1
7	B8K1W2	1303	1325	0.512	0.495	ABCBB_CANLF Bile salt export pump OS=Canis lupus familiaris OX=9615 GN=Abcb11e PE=1 SV=1
8	E7F1E3	1702	1275	0.630	0.632	E7F1E3_DANRE ATP-binding cassette, sub-family B (MDR/TAP), member 4 OS=Danio rerio OX=7955 GN=zgc:172149 PE=4 SV=1
9	F1R7A8	1523	1338	0.577	0.552	F1R7A8_DANRE ABC transporter B family member 5 (Fragment) OS=Danio rerio OX=7955 GN=abcb5 PE=1 SV=1
10	F7FKA8	2230	1286	0.863	0.859	F7FKA8_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
11	G5EDF9	1133	1272	0.448	0.451	G5EDF9_CAEEL ABC transporter PGP-2 OS=Caenorhabditis elegans OX=6239 GN=pgp-2 PE=1 SV=1
12	G5EG61	852	1327	0.386	0.372	G5EG61_CAEEL p-GlycoProtein related OS=Caenorhabditis elegans OX=6239 GN=pgp-14 PE=1 SV=1
13	M9PEB5	918	1206	0.384	0.407	M9PEB5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=AMT PE=4 SV=1
14	O70127	1264	1321	0.502	0.486	ABCBB_RAT Bile salt export pump OS=Rattus norvegicus OX=10116 GN=Abcb11 PE=1 SV=1
15	O80725	1004	1286	0.423	0.421	AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCB4 PE=1 SV=1
16	O93437	1825	1288	0.705	0.701	O93437_CHICK ABC transporter protein (P-glycoprotein) OS=Gallus gallus OX=9031 GN=cmdr1 PE=2 SV=2
17	O95342	1320	1321	0.518	0.502	ABCBB_HUMAN Bile salt export pump OS=Homo sapiens OX=9606 GN=ABCB11 PE=1 SV=2
18	P06795	2129	1276	0.806	0.809	MDR1B_MOUSE ATP-dependent translocase ABCB1 OS=Mus musculus OX=10090 GN=Abcb1b PE=1 SV=1
19	P08183	2627	1280	1.000	1.000	MDR1_HUMAN ATP-dependent translocase ABCB1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=1 SV=3
20	P21439	1972	1286	0.763	0.760	MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens OX=9606 GN=ABCB4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	0.016	27.1	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	0.69	21.4	AAA domain
3	PF13175 AAA_15	3.5	18.7	AAA ATPase domain
4	PF13191 AAA_16	4.8e-06	38.5	AAA ATPase domain
5	PF13238 AAA_18	52	15.8	AAA domain
6	PF13304 AAA_21	1e+02	14.1	AAA domain, putative AbiEii toxin, Type IV TA system
7	PF13401 AAA_22	3.8e-05	35.4	AAA domain
8	PF13479 AAA_24	10	17.3	AAA domain
9	PF13481 AAA_25	54	14.8	AAA domain
10	PF13521 AAA_28	5.2	18.8	AAA domain
11	PF13555 AAA_29	0.044	24.8	P-loop containing region of AAA domain
12	PF13604 AAA_30	0.83	20.9	AAA domain
13	PF13671 AAA_33	21	16.7	AAA domain
14	PF07728 AAA_5	0.08	24.4	AAA domain (dynein-related subfamily)
15	PF12775 AAA_7	0.36	21.8	P-loop containing dynein motor region
16	PF09818 ABC_ATPase	3.4e-08	44.5	ATPase of the ABC class
17	PF00664 ABC_membrane	5.6e-170	575.7	ABC transporter transmembrane region
18	PF00005 ABC_tran	2.9e-72	253.1	ABC transporter
19	PF01583 APS_kinase	1.2	20.5	Adenylylsulphate kinase
20	PF00006 ATP-synt_ab	2.8	19.1	ATP synthase alpha/beta family, nucleotide-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337915	0.964	Cytochrome P450 3A4
2	9606.ENSP00000269305	0.960	Cellular tumor antigen p53
3	9606.ENSP00000339191	0.942	Caveolin-1
4	9606.ENSP00000378974	0.918	Mitogen-activated protein kinase 8
5	9606.ENSP00000263253	0.917	Histone acetyltransferase p300
6	9606.ENSP00000254719	0.903	Replication protein A 70 kDa DNA-binding subunit
7	9606.ENSP00000406549	0.901	Transcription initiation factor TFIID subunit 1
8	9606.ENSP00000222982	0.885	Cytochrome P450 3A5
9	9606.ENSP00000245539	0.824	Mitochondrial ribosomal protein S7
10	9606.ENSP00000256958	0.811	Solute carrier organic anion transporter family member 1B1
11	9606.ENSP00000265723	0.811	Phosphatidylcholine translocator ABCB4
12	9606.ENSP00000360372	0.767	Cytochrome P450 2C19
13	9606.ENSP00000222388	0.755	ATP binding cassette subfamily F member 2
14	9606.ENSP00000336528	0.754	Nuclear receptor subfamily 1 group I member 2
15	9606.ENSP00000260970	0.751	Peptidyl-prolyl cis-trans isomerase G
16	9606.ENSP00000353820	0.748	Cytochrome P450 2D6
17	9606.ENSP00000347379	0.736	Occludin
18	9606.ENSP00000261196	0.720	Solute carrier organic anion transporter family member 1B3
19	9606.ENSP00000441269	0.720	Solute carrier organic anion transporter family member
20	9606.ENSP00000260682	0.719	Cytochrome P450 2C9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022857	0.997	transmembrane transporter activity
GO:0005488	0.996	binding
GO:0005515	0.994	protein binding
GO:0022804	0.983	active transmembrane transporter activity
GO:0140657	0.979	ATP-dependent activity
GO:0042626	0.973	ATPase-coupled transmembrane transporter activity
GO:0015562	0.921	efflux transmembrane transporter activity
GO:0042910	0.718	xenobiotic transmembrane transporter activity
GO:0003824	0.535	catalytic activity
GO:0140359	0.416	ABC-type transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0009987	0.983	cellular process
GO:0042221	0.973	response to chemical
GO:0009636	0.834	response to toxic substance
GO:0065007	0.778	biological regulation
GO:0051179	0.748	localization
GO:0006810	0.737	transport
GO:0051716	0.593	cellular response to stimulus
GO:0050789	0.588	regulation of biological process
GO:0050794	0.460	regulation of cellular process
GO:0070887	0.381	cellular response to chemical stimulus
GO:0008152	0.351	metabolic process
GO:0032501	0.339	multicellular organismal process
GO:0065008	0.327	regulation of biological quality
GO:0048518	0.305	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098590	0.971	plasma membrane region
GO:0045177	0.959	apical part of cell
GO:0043226	0.958	organelle
GO:0043227	0.954	membrane-bounded organelle
GO:0043231	0.927	intracellular membrane-bounded organelle
GO:0016324	0.906	apical plasma membrane
GO:0005737	0.811	cytoplasm
GO:0070013	0.387	intracellular organelle lumen
GO:0031981	0.372	nuclear lumen
GO:0005654	0.303	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.973	Translocases.

[back to server]