StarFunc result for job id P08235

User Input

>input (984 residues)
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE
QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAV
VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN
VENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP
SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVN
TALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQV
VKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI
KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAML
VEIISDQLPKVESGNAKPLYFHRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0ZBF6	0.299	0.299	8.297E-102	984	1.000	1.000	B0ZBF6.pdb.gz	B0ZBF6_HUMAN Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=4 SV=1
2	AFDB:C1KB84	0.288	0.287	1.319E-85	986	0.824	0.823	C1KB84.pdb.gz	C1KB84_CHICK Mineralocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C2 PE=2 SV=1
3	AFDB:G1K325	0.273	0.285	3.115E-78	942	0.786	0.821	G1K325.pdb.gz
4	AFDB:A6YIH7	0.404	0.409	1.606E-59	970	0.515	0.523	A6YIH7.pdb.gz	A6YIH7_DANRE Mineralocorticoid receptor OS=Danio rerio OX=7955 GN=mr PE=2 SV=1
5	AFDB:P06401	0.316	0.332	6.979E-37	933	0.307	0.324	P06401.pdb.gz	PRGR_HUMAN Progesterone receptor OS=Homo sapiens OX=9606 GN=PGR PE=1 SV=4
6	AFDB:Q00175	0.327	0.346	4.374E-36	926	0.320	0.340	Q00175.pdb.gz	PRGR_MOUSE Progesterone receptor OS=Mus musculus OX=10090 GN=Pgr PE=1 SV=2
7	PDB:7kw7F	0.222	0.808	2.683E-20	259	0.148	0.564	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
8	PDB:3dzyA	0.199	0.617	6.338E-13	302	0.089	0.291	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
9	PDB:6fx0A	0.198	0.730	1.007E-7	238	0.047	0.193	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
10	PDB:1g2nA	0.189	0.713	2.408E-7	246	0.055	0.220	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
11	AFDB:Q9C6S1	0.065	0.055	6.618E-3	1230	0.140	0.112	Q9C6S1.pdb.gz	FH14_ARATH Formin-like protein 14 OS=Arabidopsis thaliana OX=3702 GN=FH14 PE=3 SV=3
12	AFDB:Q86M88	0.054	0.048	7.952E-3	1175	0.135	0.113	Q86M88.pdb.gz	Q86M88_DICDI ComD OS=Dictyostelium discoideum OX=44689 GN=comD PE=4 SV=1
13	AFDB:Q9VCH1	0.070	0.042	1.583E-2	2072	0.158	0.075	Q9VCH1.pdb.gz	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
14	AFDB:Q9FJX6	0.067	0.071	1.991E-2	899	0.133	0.146	Q9FJX6.pdb.gz	FH6_ARATH Formin-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=FH6 PE=2 SV=1
15	PDB:7jvrR	0.071	0.165	6.288E-1	269	0.033	0.119	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
16	PDB:5xezB	0.049	0.083	6.892E-1	499	0.035	0.068	5xezB.pdb.gz	Structure of the full-length glucagon class B G-protein-coupled receptor.
17	PDB:1h2sA	0.061	0.180	8.280E-1	225	0.029	0.129	1h2sA.pdb.gz	Molecular Basis of Transmembrane Signalling by Sensory Rhodopsin II-Transducer Complex
18	PDB:7ew2R	0.066	0.155	9.503E-1	290	0.034	0.114	7ew2R.pdb.gz	Structural insights into sphingosine-1-phosphate recognition and ligand selectivity of S1PR3-Gi signaling complexes.
19	PDB:7oqzA	0.062	0.151	9.503E-1	237	0.027	0.114	7oqzA.pdb.gz
20	PDB:5ivw2	0.070	0.176	1.042	274	0.024	0.088	5ivw2.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6YIH7	0.0	887	970	0.521	0.529	A6YIH7_DANRE Mineralocorticoid receptor OS=Danio rerio OX=7955 GN=mr PE=2 SV=1
2	B0ZBF6	0.0	2026	984	1.000	1.000	B0ZBF6_HUMAN Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=4 SV=1
3	C1KB84	0.0	1560	986	0.825	0.824	C1KB84_CHICK Mineralocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C2 PE=2 SV=1
4	P08235	0.0	2026	984	1.000	1.000	MCR_HUMAN Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=1 SV=2
5	P22199	0.0	1725	981	0.899	0.902	MCR_RAT Mineralocorticoid receptor OS=Rattus norvegicus OX=10116 GN=Nr3c2 PE=1 SV=1
6	Q8VII8	0.0	1762	978	0.904	0.910	MCR_MOUSE Mineralocorticoid receptor OS=Mus musculus OX=10090 GN=Nr3c2 PE=1 SV=2
7	Q9IAC6	7.71e-171	504	359	0.250	0.685	MCR_ONCMY Mineralocorticoid receptor (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=nr3c2 PE=2 SV=1
8	Q38HX7	2.27e-159	490	772	0.300	0.382	Q38HX7_CHICK Glucocorticoid receptor OS=Gallus gallus OX=9031 GN=GR PE=2 SV=1
9	Q6RKQ3	3.95e-159	486	669	0.256	0.377	Q6RKQ3_ONCMY Glucocorticoid receptor OS=Oncorhynchus mykiss OX=8022 GN=nr3c1 PE=2 SV=1
10	A0A1D5PRD7	4.64e-159	489	772	0.274	0.350	A0A1D5PRD7_CHICK Glucocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C1 PE=1 SV=1
11	F1D8N4	8.06e-159	489	777	0.264	0.335	F1D8N4_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=2 SV=1
12	P04150	8.06e-159	489	777	0.264	0.335	GCR_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=1 SV=1
13	Q1XHK0	1.90e-157	484	746	0.268	0.354	Q1XHK0_DANRE Glucocorticoid receptor OS=Danio rerio OX=7955 GN=fb13f09 PE=2 SV=1
14	E5KQF6	5.17e-157	484	778	0.264	0.334	E5KQF6_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=3 SV=1
15	P06537	1.35e-156	483	792	0.264	0.328	GCR_MOUSE Glucocorticoid receptor OS=Mus musculus OX=10090 GN=Nr3c1 PE=1 SV=2
16	P49843	1.64e-155	479	758	0.264	0.343	GCR_ONCMY Glucocorticoid receptor OS=Oncorhynchus mykiss OX=8022 GN=nr3c1 PE=1 SV=1
17	P06536	1.57e-152	473	795	0.264	0.327	GCR_RAT Glucocorticoid receptor OS=Rattus norvegicus OX=10116 GN=Nr3c1 PE=1 SV=2
18	Q690N0	2.62e-149	453	482	0.225	0.459	Q690N0_BOVIN Progesterone receptor (Fragment) OS=Bos taurus OX=9913 GN=PGR PE=2 SV=1
19	P07812	6.26e-149	463	786	0.231	0.289	PRGR_CHICK Progesterone receptor OS=Gallus gallus OX=9031 GN=PGR PE=1 SV=1
20	A0A494C0P1	3.27e-144	449	746	0.250	0.330	A0A494C0P1_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	3.7e-25	100.3	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	5.4e-25	99.0	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350815

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316786	0.945	Corticosteroid 11-beta-dehydrogenase isozyme 2
2	9606.ENSP00000335153	0.941	Heat shock protein HSP 90-alpha
3	9606.ENSP00000001008	0.936	Peptidyl-prolyl cis-trans isomerase FKBP4
4	9606.ENSP00000385216	0.928	Nuclear receptor coactivator 1
5	9606.ENSP00000348056	0.927	SUMO-conjugating enzyme UBC9
6	9606.ENSP00000401010	0.926	F-actin-capping protein subunit beta
7	9606.ENSP00000249636	0.923	E3 SUMO-protein ligase PIAS1
8	9606.ENSP00000444810	0.917	Peptidyl-prolyl cis-trans isomerase FKBP5
9	9606.ENSP00000380308	0.911	Cytoplasmic dynein 1 intermediate chain 2
10	9606.ENSP00000320130	0.908	Cytoplasmic dynein 1 intermediate chain 1
11	9606.ENSP00000408910	0.905	Dynactin subunit 2
12	9606.ENSP00000258198	0.903	Cytoplasmic dynein 1 light intermediate chain 2
13	9606.ENSP00000477310	0.903	Dynein light chain 2, cytoplasmic
14	9606.ENSP00000263168	0.902	F-actin-capping protein subunit alpha-1
15	9606.ENSP00000376297	0.902	Dynein light chain 1, cytoplasmic
16	9606.ENSP00000254286	0.901	Actin related protein 10 homolog
17	9606.ENSP00000273130	0.901	Cytoplasmic dynein 1 light intermediate chain 1
18	9606.ENSP00000326238	0.901	F-actin-capping protein subunit alpha-3
19	9606.ENSP00000354947	0.901	F-actin-capping protein subunit alpha-2
20	9606.ENSP00000358921	0.901	Alpha-centractin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990239	1.000	steroid hormone binding
GO:0038023	0.995	signaling receptor activity
GO:0005515	0.980	protein binding
GO:0003707	0.966	nuclear steroid receptor activity
GO:1901363	0.965	heterocyclic compound binding
GO:0003676	0.929	nucleic acid binding
GO:0140110	0.926	transcription regulator activity
GO:0003700	0.891	DNA-binding transcription factor activity
GO:0003677	0.769	DNA binding
GO:0043565	0.705	sequence-specific DNA binding
GO:0003690	0.587	double-stranded DNA binding
GO:1990837	0.491	sequence-specific double-stranded DNA binding
GO:0000981	0.468	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.394	transcription cis-regulatory region binding
GO:0000978	0.348	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0098531	0.316	ligand-activated transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.986	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0051716	0.969	cellular response to stimulus
GO:0048518	0.929	positive regulation of biological process
GO:0007154	0.878	cell communication
GO:0042221	0.867	response to chemical
GO:0023052	0.865	signaling
GO:0070887	0.850	cellular response to chemical stimulus
GO:0010033	0.849	response to organic substance
GO:0032501	0.844	multicellular organismal process
GO:0010646	0.813	regulation of cell communication
GO:0023051	0.809	regulation of signaling
GO:0048522	0.795	positive regulation of cellular process
GO:0048583	0.754	regulation of response to stimulus
GO:0071310	0.736	cellular response to organic substance
GO:0009719	0.704	response to endogenous stimulus
GO:0071407	0.704	cellular response to organic cyclic compound
GO:0071495	0.694	cellular response to endogenous stimulus
GO:1901701	0.691	cellular response to oxygen-containing compound
GO:0048545	0.648	response to steroid hormone
GO:0032870	0.616	cellular response to hormone stimulus
GO:1901654	0.612	response to ketone
GO:0071396	0.611	cellular response to lipid
GO:0019222	0.587	regulation of metabolic process
GO:0060255	0.560	regulation of macromolecule metabolic process
GO:0080090	0.557	regulation of primary metabolic process
GO:0031323	0.555	regulation of cellular metabolic process
GO:0051171	0.554	regulation of nitrogen compound metabolic process
GO:0071383	0.531	cellular response to steroid hormone stimulus
GO:1901655	0.524	cellular response to ketone
GO:0010468	0.497	regulation of gene expression
GO:0071384	0.464	cellular response to corticosteroid stimulus
GO:0065008	0.440	regulation of biological quality
GO:0009893	0.421	positive regulation of metabolic process
GO:0009966	0.417	regulation of signal transduction
GO:0009889	0.416	regulation of biosynthetic process
GO:0031326	0.408	regulation of cellular biosynthetic process
GO:0019219	0.405	regulation of nucleobase-containing compound metabolic process
GO:0051179	0.395	localization
GO:0010556	0.364	regulation of macromolecule biosynthetic process
GO:0048519	0.363	negative regulation of biological process
GO:0051049	0.338	regulation of transport
GO:0007165	0.328	signal transduction
GO:0006355	0.328	regulation of DNA-templated transcription
GO:0008152	0.324	metabolic process
GO:0031325	0.309	positive regulation of cellular metabolic process
GO:0051384	0.307	response to glucocorticoid
GO:0010604	0.305	positive regulation of macromolecule metabolic process
GO:0071704	0.300	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.988	cytosol
GO:0016020	0.748	membrane
GO:0032991	0.391	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]