StarFunc result for job id P08237

User Input

>input (780 residues)
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3o8lA	0.944	0.984	0.000	748	0.926	0.965	3o8lA.pdb.gz	The Crystal Structures of Eukaryotic Phosphofructokinases from Baker's Yeast and Rabbit Skeletal Muscle.
2	PDB:4xyjA	0.948	0.962	0.000	768	0.708	0.719	4xyjA.pdb.gz	Structures of human phosphofructokinase-1 and atomic basis of cancer-associated mutations.
3	PDB:7lw1A	0.945	0.990	0.000	744	0.677	0.710	7lw1A.pdb.gz	Selective activation of PFKL suppresses the phagocytic oxidative burst.
4	AFDB:A0A060WI24	0.985	0.985	0.000	780	0.753	0.753	A0A060WI24.pdb.gz	A0A060WI24_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00075887001 PE=3 SV=1
5	AFDB:A0A060X7Z0	0.982	0.945	0.000	811	0.783	0.753	A0A060X7Z0.pdb.gz	A0A060X7Z0_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028237001 PE=3 SV=1
6	AFDB:P00511	0.997	0.997	0.000	780	0.962	0.962	P00511.pdb.gz	PFKAM_RABIT ATP-dependent 6-phosphofructokinase, muscle type OS=Oryctolagus cuniculus OX=9986 GN=PFKM PE=1 SV=3
7	AFDB:P12382	0.983	0.983	0.000	780	0.686	0.686	P12382.pdb.gz	PFKAL_MOUSE ATP-dependent 6-phosphofructokinase, liver type OS=Mus musculus OX=10090 GN=Pfkl PE=1 SV=4
8	AFDB:P47859	0.961	0.948	0.000	791	0.696	0.686	P47859.pdb.gz	PFKAP_RABIT ATP-dependent 6-phosphofructokinase, platelet type OS=Oryctolagus cuniculus OX=9986 GN=PFKP PE=1 SV=1
9	AFDB:P47860	0.969	0.960	0.000	788	0.703	0.695	P47860.pdb.gz	PFKAP_RAT ATP-dependent 6-phosphofructokinase, platelet type OS=Rattus norvegicus OX=10116 GN=Pfkp PE=1 SV=2
10	AFDB:P52034	0.968	0.958	0.000	788	0.591	0.585	P52034.pdb.gz	PFKA_DROME ATP-dependent 6-phosphofructokinase OS=Drosophila melanogaster OX=7227 GN=Pfk PE=2 SV=2
11	AFDB:Q8AYP9	0.977	0.990	0.000	770	0.696	0.705	Q8AYP9.pdb.gz	Q8AYP9_CHICK ATP-dependent 6-phosphofructokinase OS=Gallus gallus OX=9031 GN=pfk PE=2 SV=1
12	AFDB:Q90YA3	0.966	0.980	0.000	769	0.815	0.827	Q90YA3.pdb.gz	Q90YA3_CHICK ATP-dependent 6-phosphofructokinase OS=Gallus gallus OX=9031 GN=pfk PE=2 SV=1
13	AFDB:O42938	0.933	0.774	1.476E-87	942	0.444	0.367	O42938.pdb.gz	PFKA_SCHPO ATP-dependent 6-phosphofructokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfk1 PE=1 SV=1
14	PDB:4a3sA	0.370	0.894	1.014E-26	319	0.179	0.439	4a3sA.pdb.gz
15	PDB:1pfkA	0.367	0.883	9.957E-26	320	0.169	0.412	1pfkA.pdb.gz	Crystal structure of the complex of phosphofructokinase from Escherichia coli with its reaction products.
16	PDB:6qu3A	0.352	0.574	2.415E-18	464	0.110	0.185	6qu3A.pdb.gz	Fast acting allosteric phosphofructokinase inhibitors block trypanosome glycolysis and cure acute African trypanosomiasis in mice.
17	PDB:1kzhB	0.345	0.494	8.130E-15	530	0.096	0.142	1kzhB.pdb.gz	The structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi.
18	PDB:2f48B	0.344	0.473	1.709E-13	552	0.099	0.139	2f48B.pdb.gz	Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
19	PDB:3hazA	0.154	0.131	1.221E-3	983	0.117	0.093	3hazA.pdb.gz	Crystal structure of the bifunctional proline utilization A flavoenzyme from Bradyrhizobium japonicum
20	PDB:3oqoA	0.161	0.304	1.655E-3	333	0.056	0.132	3oqoA.pdb.gz	Structures of carbon catabolite protein A-(HPr-Ser46-P) bound to diverse catabolite response element sites reveal the basis for high-affinity binding to degenerate DNA operators.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060WI24	1254	780	0.753	0.753	A0A060WI24_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00075887001 PE=3 SV=1
2	A0A060X7Z0	1260	811	0.785	0.755	A0A060X7Z0_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028237001 PE=3 SV=1
3	O14943	570	412	0.358	0.677	O14943_HUMAN Phosphofructokinase-P (Fragment) OS=Homo sapiens OX=9606 GN=PFK-P PE=2 SV=1
4	O42938	658	942	0.451	0.374	PFKA_SCHPO ATP-dependent 6-phosphofructokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfk1 PE=1 SV=1
5	P00511	1570	780	0.963	0.963	PFKAM_RABIT ATP-dependent 6-phosphofructokinase, muscle type OS=Oryctolagus cuniculus OX=9986 GN=PFKM PE=1 SV=3
6	P08237	1615	780	1.000	1.000	PFKAM_HUMAN ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM PE=1 SV=2
7	P12382	1163	780	0.685	0.685	PFKAL_MOUSE ATP-dependent 6-phosphofructokinase, liver type OS=Mus musculus OX=10090 GN=Pfkl PE=1 SV=4
8	P16861	577	987	0.422	0.333	PFKA1_YEAST ATP-dependent 6-phosphofructokinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK1 PE=1 SV=1
9	P16862	627	959	0.415	0.338	PFKA2_YEAST ATP-dependent 6-phosphofructokinase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK2 PE=1 SV=4
10	P17858	1164	780	0.686	0.686	PFKAL_HUMAN ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6
11	P30835	1165	780	0.686	0.686	PFKAL_RAT ATP-dependent 6-phosphofructokinase, liver type OS=Rattus norvegicus OX=10116 GN=Pfkl PE=1 SV=3
12	P47857	1587	780	0.978	0.978	PFKAM_MOUSE ATP-dependent 6-phosphofructokinase, muscle type OS=Mus musculus OX=10090 GN=Pfkm PE=1 SV=3
13	P47858	1565	780	0.967	0.967	PFKAM_RAT ATP-dependent 6-phosphofructokinase, muscle type OS=Rattus norvegicus OX=10116 GN=Pfkm PE=1 SV=3
14	P47859	1125	791	0.700	0.690	PFKAP_RABIT ATP-dependent 6-phosphofructokinase, platelet type OS=Oryctolagus cuniculus OX=9986 GN=PFKP PE=1 SV=1
15	P47860	1128	788	0.701	0.694	PFKAP_RAT ATP-dependent 6-phosphofructokinase, platelet type OS=Rattus norvegicus OX=10116 GN=Pfkp PE=1 SV=2
16	P52034	941	788	0.587	0.581	PFKA_DROME ATP-dependent 6-phosphofructokinase OS=Drosophila melanogaster OX=7227 GN=Pfk PE=2 SV=2
17	P90521	639	834	0.408	0.381	PFKA_DICDI ATP-dependent 6-phosphofructokinase OS=Dictyostelium discoideum OX=44689 GN=pfkA PE=1 SV=2
18	Q01813	1148	784	0.708	0.704	PFKAP_HUMAN ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2
19	Q5AGZ8	622	946	0.413	0.340	Q5AGZ8_CANAL ATP-dependent 6-phosphofructokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PFK2 PE=3 SV=1
20	Q5AK53	662	987	0.449	0.355	Q5AK53_CANAL ATP-dependent 6-phosphofructokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PFK1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00365 PFK	6.1e-196	660.8	Phosphofructokinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000056036

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000044721	0.998	Glucose-6-phosphate isomerase
2	9598.ENSPTRP00000015230	0.994	Pan troglodytes aldolase C, fructose-bisphosphate (ALDOC), mRNA
3	9598.ENSPTRP00000055755	0.994	Plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein (By similarity).
4	9598.ENSPTRP00000036234	0.993	Belongs to the class I fructose-bisphosphate aldolase family
5	9598.ENSPTRP00000003790	0.977	ATP-dependent 6-phosphofructokinase
6	9598.ENSPTRP00000005525	0.964	Transaldolase
7	9598.ENSPTRP00000020771	0.960	Hexokinase 2
8	9598.ENSPTRP00000030009	0.960	Uncharacterized protein
9	9598.ENSPTRP00000004454	0.955	Uncharacterized protein
10	9598.ENSPTRP00000036126	0.952	Uncharacterized protein
11	9598.ENSPTRP00000036128	0.952	Uncharacterized protein
12	9598.ENSPTRP00000051315	0.940	Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate
13	9598.ENSPTRP00000028429	0.923	Uncharacterized protein
14	9598.ENSPTRP00000038655	0.923	Uncharacterized protein
15	9598.ENSPTRP00000012471	0.921	Involved in the synthesis of the GDP-mannose and dolichol- phosphate-mannose required for a number of critical mannosyl transfer reactions
16	9598.ENSPTRP00000003834	0.918	6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 3
17	9598.ENSPTRP00000057240	0.892	Pan troglodytes triosephosphate isomerase 1 (TPI1), mRNA
18	9598.ENSPTRP00000007780	0.889	Chromosome 12 open reading frame 5
19	9598.ENSPTRP00000003226	0.875	6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2
20	9598.ENSPTRP00000025688	0.861	6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003872	0.999	6-phosphofructokinase activity
GO:0005488	0.996	binding
GO:0005515	0.974	protein binding
GO:1901363	0.700	heterocyclic compound binding
GO:0097159	0.700	organic cyclic compound binding
GO:0043167	0.569	ion binding
GO:0042802	0.442	identical protein binding
GO:0036094	0.362	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006096	0.996	glycolytic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.840	membrane-bounded organelle
GO:0043229	0.836	intracellular organelle
GO:0043231	0.799	intracellular membrane-bounded organelle
GO:0032991	0.685	protein-containing complex
GO:1902494	0.584	catalytic complex
GO:1990234	0.410	transferase complex
GO:0061695	0.388	transferase complex, transferring phosphorus-containing groups

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16109	0.999	ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H(+)
EC:2.7.1.11	0.999	6-phosphofructokinase.

[back to server]