StarFunc result for job id P08238

User Input

>input (724 residues)
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRM
EEVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RD80	0.955	0.955	0.000	724	1.000	1.000	A0A024RD80.pdb.gz
2	AFDB:A0A060XFW6	0.898	0.842	0.000	773	0.898	0.841	A0A060XFW6.pdb.gz	A0A060XFW6_ONCMY Histidine kinase/HSP90-like ATPase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028101001 PE=3 SV=1
3	AFDB:A0A1D5P5R0	0.890	0.887	0.000	727	0.823	0.820	A0A1D5P5R0.pdb.gz
4	AFDB:P02828	0.903	0.912	0.000	717	0.775	0.782	P02828.pdb.gz	HSP83_DROME Heat shock protein 83 OS=Drosophila melanogaster OX=7227 GN=Hsp83 PE=1 SV=1
5	AFDB:P07901	0.920	0.909	0.000	733	0.866	0.855	P07901.pdb.gz	HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4
6	AFDB:P27323	0.887	0.916	0.000	700	0.693	0.717	P27323.pdb.gz	HS901_ARATH Heat shock protein 90-1 OS=Arabidopsis thaliana OX=3702 GN=HSP90-1 PE=1 SV=3
7	AFDB:Q0Q0I7	0.890	0.920	0.000	700	0.681	0.704	Q0Q0I7.pdb.gz	Q0Q0I7_WHEAT Heat shock protein 90 OS=Triticum aestivum OX=4565 GN=HSP90-2 PE=1 SV=1
8	AFDB:Q18688	0.914	0.942	0.000	702	0.746	0.769	Q18688.pdb.gz	HSP90_CAEEL Heat shock protein 90 OS=Caenorhabditis elegans OX=6239 GN=daf-21 PE=1 SV=1
9	AFDB:Q90474	0.904	0.903	0.000	725	0.827	0.826	Q90474.pdb.gz	H90A1_DANRE Heat shock protein HSP 90-alpha 1 OS=Danio rerio OX=7955 GN=hsp90a.1 PE=1 SV=3
10	AFDB:Q9BLC5	0.899	0.908	0.000	716	0.822	0.831	Q9BLC5.pdb.gz	HSP83_BOMMO Heat shock protein 83 OS=Bombyx mori OX=7091 GN=Hsp83 PE=1 SV=1
11	PDB:5fwkA	0.845	0.956	2.032E-100	638	0.869	0.986	5fwkA.pdb.gz	Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
12	PDB:7kw7B	0.783	0.898	1.482E-92	628	0.776	0.895	7kw7B.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
13	PDB:2cg9B	0.807	0.942	1.378E-71	618	0.552	0.647	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
14	PDB:7kclB	0.712	0.830	1.903E-53	614	0.285	0.336	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
15	PDB:2iopA	0.484	0.561	5.069E-52	618	0.344	0.403	2iopA.pdb.gz	Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
16	PDB:5tthA	0.610	0.652	6.605E-52	671	0.273	0.295	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
17	PDB:5tthB	0.682	0.786	1.713E-51	621	0.278	0.324	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
18	PDB:1y4uB	0.364	0.564	2.013E-43	454	0.283	0.452	1y4uB.pdb.gz
19	PDB:7p8vA	0.298	0.573	1.229E-10	331	0.081	0.178	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
20	PDB:6rkwD	0.332	0.311	1.689E-10	781	0.095	0.088	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060XFW6	1241	773	0.880	0.824	A0A060XFW6_ONCMY Histidine kinase/HSP90-like ATPase domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028101001 PE=3 SV=1
2	A0A0G2JH20	1197	705	0.831	0.854	A0A0G2JH20_RABIT Heat shock protein 90 alpha family class A member 1 OS=Oryctolagus cuniculus OX=9986 GN=HSP90AA1 PE=3 SV=2
3	A0A1D5PUL6	1196	728	0.862	0.857	A0A1D5PUL6_CHICK Heat shock protein 90 alpha family class A member 1 OS=Gallus gallus OX=9031 GN=HSP90AA1 PE=3 SV=1
4	B9R8A7	661	816	0.481	0.426	B9R8A7_RICCO Endoplasmin, putative OS=Ricinus communis OX=3988 GN=RCOM_1598250 PE=3 SV=1
5	C7G492	1179	728	0.862	0.857	C7G492_COTJA Heat shock protein 90kDa alpha (Cytosolic), class A member 1 OS=Coturnix japonica OX=93934 GN=HSP90AA1 PE=2 SV=1
6	C7G496	1177	728	0.859	0.854	C7G496_COTJA Heat shock protein 90kDa alpha (Cytosolic), class A member 1 OS=Coturnix japonica OX=93934 GN=HSP90AA1 PE=3 SV=1
7	F4JFN3	586	799	0.430	0.389	HS906_ARATH Heat shock protein 90-6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HSP90-6 PE=1 SV=1
8	F4K6B6	613	728	0.417	0.415	F4K6B6_ARATH Heat shock protein 81-2 OS=Arabidopsis thaliana OX=3702 GN=HSP81-2 PE=1 SV=1
9	O03986	629	699	0.421	0.436	HS904_ARATH Heat shock protein 90-4 OS=Arabidopsis thaliana OX=3702 GN=HSP90-4 PE=1 SV=1
10	O57521	1263	725	0.901	0.899	HS90B_DANRE Heat shock protein HSP 90-beta OS=Danio rerio OX=7955 GN=hsp90ab1 PE=1 SV=2
11	P02828	1142	717	0.775	0.782	HSP83_DROME Heat shock protein 83 OS=Drosophila melanogaster OX=7227 GN=Hsp83 PE=1 SV=1
12	P02829	837	709	0.610	0.623	HSP82_YEAST ATP-dependent molecular chaperone HSP82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSP82 PE=1 SV=1
13	P07900	1196	732	0.862	0.852	HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5
14	P07901	1199	733	0.854	0.843	HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4
15	P08110	616	795	0.456	0.415	ENPL_CHICK Endoplasmin OS=Gallus gallus OX=9031 GN=HSP90B1 PE=1 SV=1
16	P08113	615	802	0.457	0.413	ENPL_MOUSE Endoplasmin OS=Mus musculus OX=10090 GN=Hsp90b1 PE=1 SV=2
17	P08238	1479	724	1.000	1.000	HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4
18	P11499	1475	724	0.996	0.996	HS90B_MOUSE Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3
19	P11501	1193	728	0.860	0.856	HS90A_CHICK Heat shock protein HSP 90-alpha OS=Gallus gallus OX=9031 GN=HSP90AA1 PE=3 SV=3
20	P12861	858	703	0.597	0.615	HSP83_TRYBB Heat shock protein 83 OS=Trypanosoma brucei brucei OX=5702 GN=HSP83 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02518 HATPase_c	1.4e-10	53.0	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
2	PF13589 HATPase_c_3	1.2e-06	40.0	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF00183 HSP90	4e-229	773.6	Hsp90 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360609

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222005	0.999	Hsp90 co-chaperone Cdc37
2	9606.ENSP00000351646	0.999	Stress-induced-phosphoprotein 1
3	9606.ENSP00000367208	0.999	Protein SGT1 homolog
4	9606.ENSP00000482075	0.998	Prostaglandin E synthase 3
5	9606.ENSP00000216479	0.996	Activator of 90 kDa heat shock protein ATPase homolog 1
6	9606.ENSP00000432083	0.996	Heat shock cognate 71 kDa protein
7	9606.ENSP00000335153	0.994	Heat shock protein HSP 90-alpha
8	9606.ENSP00000362680	0.993	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000254322	0.992	DnaJ homolog subfamily B member 1
10	9606.ENSP00000373620	0.990	60 kDa heat shock protein, mitochondrial
11	9606.ENSP00000012443	0.987	Serine/threonine-protein phosphatase 5
12	9606.ENSP00000364802	0.985	Heat shock 70 kDa protein 1A
13	9606.ENSP00000303754	0.984	Peptidyl-prolyl cis-trans isomerase D
14	9606.ENSP00000451828	0.983	RAC-alpha serine/threonine-protein kinase
15	9606.ENSP00000279146	0.979	AH receptor-interacting protein
16	9606.ENSP00000297494	0.979	Nitric oxide synthase, endothelial
17	9606.ENSP00000444810	0.979	Peptidyl-prolyl cis-trans isomerase FKBP5
18	9606.ENSP00000001008	0.977	Peptidyl-prolyl cis-trans isomerase FKBP4
19	9606.ENSP00000231509	0.975	Glucocorticoid receptor
20	9606.ENSP00000299300	0.973	T-complex protein 1 subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.917	catalytic activity
GO:0042802	0.833	identical protein binding
GO:0097159	0.794	organic cyclic compound binding
GO:1901363	0.793	heterocyclic compound binding
GO:0016887	0.735	ATP hydrolysis activity
GO:0019899	0.638	enzyme binding
GO:0043167	0.512	ion binding
GO:0003676	0.503	nucleic acid binding
GO:0003723	0.303	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.976	biological regulation
GO:0050896	0.968	response to stimulus
GO:0050789	0.953	regulation of biological process
GO:0050794	0.935	regulation of cellular process
GO:0048518	0.612	positive regulation of biological process
GO:0008152	0.585	metabolic process
GO:0048522	0.542	positive regulation of cellular process
GO:0019222	0.538	regulation of metabolic process
GO:0071704	0.501	organic substance metabolic process
GO:0080090	0.497	regulation of primary metabolic process
GO:0060255	0.493	regulation of macromolecule metabolic process
GO:0051171	0.466	regulation of nitrogen compound metabolic process
GO:0006807	0.461	nitrogen compound metabolic process
GO:0031323	0.459	regulation of cellular metabolic process
GO:0042221	0.441	response to chemical
GO:0006950	0.431	response to stress
GO:0044237	0.425	cellular metabolic process
GO:0044238	0.422	primary metabolic process
GO:0071840	0.396	cellular component organization or biogenesis
GO:0016043	0.390	cellular component organization
GO:0051716	0.386	cellular response to stimulus
GO:0048519	0.360	negative regulation of biological process
GO:0009893	0.347	positive regulation of metabolic process
GO:0043170	0.341	macromolecule metabolic process
GO:0010604	0.340	positive regulation of macromolecule metabolic process
GO:0048523	0.319	negative regulation of cellular process
GO:0051173	0.311	positive regulation of nitrogen compound metabolic process
GO:0048583	0.309	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.993	cytosol
GO:0043226	0.979	organelle
GO:0070013	0.941	intracellular organelle lumen
GO:0043227	0.909	membrane-bounded organelle
GO:0016020	0.851	membrane
GO:0043231	0.847	intracellular membrane-bounded organelle
GO:0032991	0.820	protein-containing complex
GO:0005634	0.812	nucleus
GO:0031981	0.482	nuclear lumen
GO:0071944	0.351	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.735	ATP + H2O = ADP + H(+) + phosphate

[back to server]