StarFunc result for job id P08240

User Input

>input (638 residues)
MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLDN
QFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRL
LREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKPKEKAKNSKKKGAKKEGSDGP
LATSKPVPAEKSGLPVGPENGVELSKEELIRRKREEFIQKHGRGMEKSNKSTKSDAPKEK
GKKAPRVWELGGCANKEVLDYSTPTTNGTPEAALSEDINLIRGTGSGGQLQDLDCSSSDD
EGAAQNSTKPSATKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRDHLIAKNVAADIAV
QLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYV
VTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLSALHPPEK
HGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLIT
VNTPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAA
ISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06625	0.853	0.853	3.388E-95	638	0.962	0.962	P06625.pdb.gz	SRPRA_CANLF Signal recognition particle receptor subunit alpha OS=Canis lupus familiaris OX=9615 GN=SRPRA PE=2 SV=2
2	AFDB:Q9M0A0	0.710	0.714	2.509E-52	634	0.423	0.426	Q9M0A0.pdb.gz	Q9M0A0_ARATH AT4g30600/F17I23_60 OS=Arabidopsis thaliana OX=3702 GN=At4g30600 PE=1 SV=1
3	AFDB:Q383U0	0.634	0.691	8.450E-48	582	0.323	0.354	Q383U0.pdb.gz	Q383U0_TRYB2 Signal recognition particle receptor alpha subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1650 PE=3 SV=1
4	PDB:5l3qB	0.479	0.994	3.980E-47	307	0.481	1.000	5l3qB.pdb.gz	Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
5	AFDB:O43032	0.658	0.758	5.094E-41	547	0.315	0.367	O43032.pdb.gz	SRPR_SCHPO Signal recognition particle receptor subunit alpha homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srp101 PE=3 SV=1
6	PDB:5gadi	0.392	0.544	7.493E-17	450	0.125	0.178	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
7	PDB:7obqx	0.396	0.630	6.588E-16	393	0.103	0.168	7obqx.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
8	PDB:7obrx	0.377	0.482	8.027E-16	488	0.108	0.141	7obrx.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
9	PDB:2q9cA	0.354	0.707	3.534E-15	304	0.139	0.293	2q9cA.pdb.gz	X-ray Structures of the Signal Recognition Particle Receptor Reveal Targeting Cycle Intermediates.
10	PDB:7nfxy	0.195	0.808	6.717E-15	147	0.202	0.878	7nfxy.pdb.gz	Receptor compaction and GTPase rearrangement drive SRP-mediated cotranslational protein translocation into the ER.
11	PDB:2yhsA	0.368	0.729	1.215E-14	308	0.132	0.273	2yhsA.pdb.gz
12	PDB:2ffhA	0.346	0.520	7.560E-14	407	0.132	0.206	2ffhA.pdb.gz
13	PDB:3ndbB	0.370	0.540	2.474E-13	420	0.108	0.164	3ndbB.pdb.gz	Structural basis of signal-sequence recognition by the signal recognition particle.
14	PDB:2j289	0.352	0.504	5.138E-11	430	0.125	0.186	2j289.pdb.gz	Following the Signal Sequence from Ribosomal Tunnel Exit to Signal Recognition Particle
15	AFDB:Q9UB20	0.144	0.097	3.667E-2	1042	0.099	0.060	Q9UB20.pdb.gz	Q9UB20_DROME Fs(1)YB OS=Drosophila melanogaster OX=7227 GN=fs(1)Yb PE=2 SV=1
16	AFDB:Q9GQN5	0.163	0.093	4.048E-2	1311	0.103	0.050	Q9GQN5.pdb.gz	ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster OX=7227 GN=XNP PE=1 SV=2
17	AFDB:Q92620	0.122	0.069	5.444E-2	1227	0.157	0.081	Q92620.pdb.gz	PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2
18	AFDB:Q92802	0.124	0.134	7.694E-2	583	0.092	0.101	Q92802.pdb.gz	N42L2_HUMAN NEDD4-binding protein 2-like 2 OS=Homo sapiens OX=9606 GN=N4BP2L2 PE=1 SV=1
19	AFDB:F4K2E9	0.132	0.076	1.035E-1	1255	0.129	0.065	F4K2E9.pdb.gz	PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana OX=3702 GN=CUV PE=1 SV=1
20	AFDB:Q09142	0.117	0.132	1.142E-1	535	0.083	0.099	Q09142.pdb.gz	ORC2_SCHPO Origin recognition complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06625	0.0	1234	638	0.964	0.964	SRPRA_CANLF Signal recognition particle receptor subunit alpha OS=Canis lupus familiaris OX=9615 GN=SRPRA PE=2 SV=2
2	P08240	0.0	1312	638	1.000	1.000	SRPRA_HUMAN Signal recognition particle receptor subunit alpha OS=Homo sapiens OX=9606 GN=SRPRA PE=1 SV=2
3	Q9DBG7	0.0	1269	636	0.972	0.975	SRPRA_MOUSE Signal recognition particle receptor subunit alpha OS=Mus musculus OX=10090 GN=Srpra PE=1 SV=1
4	Q9U5L1	0.0	620	614	0.517	0.537	SRPRA_DROME Signal recognition particle receptor subunit alpha homolog OS=Drosophila melanogaster OX=7227 GN=SrpRalpha PE=1 SV=2
5	Q9M0A0	9.26e-141	426	634	0.440	0.443	Q9M0A0_ARATH AT4g30600/F17I23_60 OS=Arabidopsis thaliana OX=3702 GN=At4g30600 PE=1 SV=1
6	Q383U0	1.09e-98	315	582	0.257	0.282	Q383U0_TRYB2 Signal recognition particle receptor alpha subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1650 PE=3 SV=1
7	O43032	3.08e-95	305	547	0.337	0.393	SRPR_SCHPO Signal recognition particle receptor subunit alpha homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srp101 PE=3 SV=1
8	G0S1R8	7.18e-85	293	2963	0.340	0.073	G0S1R8_CHATD non-specific serine/threonine protein kinase OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0014570 PE=1 SV=1
9	P32916	1.06e-83	277	621	0.285	0.293	SRPR_YEAST Signal recognition particle receptor subunit alpha homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRP101 PE=1 SV=2
10	P10121	1.02e-25	113	497	0.118	0.151	FTSY_ECOLI Signal recognition particle receptor FtsY OS=Escherichia coli (strain K12) OX=83333 GN=ftsY PE=1 SV=1
11	O07347	2.25e-25	111	430	0.141	0.209	SRP54_THEAQ Signal recognition particle protein OS=Thermus aquaticus OX=271 GN=ffh PE=1 SV=3
12	Q75K18	5.03e-25	111	542	0.121	0.142	SRP54_DICDI Signal recognition particle subunit SRP54 OS=Dictyostelium discoideum OX=44689 GN=srp54 PE=1 SV=1
13	O80842	4.14e-24	106	366	0.136	0.238	CFTSY_ARATH Cell division protein FtsY homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPFTSY PE=1 SV=2
14	P37107	5.67e-23	105	564	0.138	0.156	SR54C_ARATH Signal recognition particle subunit SRP54, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FFC PE=1 SV=1
15	P20424	3.46e-22	103	541	0.116	0.137	SRP54_YEAST Signal recognition particle subunit SRP54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRP54 PE=1 SV=2
16	P0AGD7	1.51e-21	100	453	0.127	0.179	SRP54_ECOLI Signal recognition particle protein OS=Escherichia coli (strain K12) OX=83333 GN=ffh PE=1 SV=1
17	A0A0H2UQC2	4.60e-21	99.4	523	0.132	0.161	A0A0H2UQC2_STRPN Signal recognition particle protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ffh PE=1 SV=1
18	P9WGD7	7.73e-21	98.6	525	0.141	0.171	SRP54_MYCTU Signal recognition particle protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ffh PE=1 SV=1
19	P21565	1.72e-20	97.8	522	0.121	0.148	SRP54_SCHPO Signal recognition particle subunit SRP54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srp54 PE=1 SV=1
20	P83749	1.43e-19	92.0	304	0.127	0.266	FTSY_THEAQ Signal recognition particle receptor FtsY OS=Thermus aquaticus OX=271 GN=ftsY PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	23	16.8	AAA ATPase domain
2	PF13604 AAA_30	21	16.3	AAA domain
3	PF02374 ArsA_ATPase	2.5e+02	12.3	Anion-transporting ATPase
4	PF01656 CbiA	1.2	20.6	CobQ/CobB/MinD/ParA nucleotide binding domain
5	PF05163 DinB	4.5e+02	12.1	DinB family
6	PF18949 DUF5693	35	14.4	Family of unknown function (DUF5693)
7	PF00142 Fer4_NifH	98	13.8	4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
8	PF03308 MeaB	0.00024	31.8	Methylmalonyl Co-A mutase-associated GTPase MeaB
9	PF00294 PfkB	36	15.1	pfkB family carbohydrate kinase
10	PF04086 SRP-alpha_N	2.4e-63	226.4	Signal recognition particle, alpha subunit, N-terminal
11	PF00448 SRP54	3.4e-44	162.4	SRP54-type protein, GTPase domain
12	PF02881 SRP54_N	5.4e-05	34.6	SRP54-type protein, helical bundle domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328023

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418401	0.999	Signal recognition particle receptor subunit beta
2	9606.ENSP00000451818	0.978	Signal recognition particle 54 kDa protein
3	9606.ENSP00000424870	0.967	Signal recognition particle 19 kDa protein
4	9606.ENSP00000312066	0.966	Signal recognition particle subunit SRP68
5	9606.ENSP00000342181	0.964	Signal recognition particle subunit SRP72
6	9606.ENSP00000389103	0.945	60S ribosomal protein L23a
7	9606.ENSP00000243253	0.929	Protein transport protein Sec61 subunit alpha isoform 1
8	9606.ENSP00000305230	0.917	Signal recognition particle 9 kDa protein
9	9606.ENSP00000346483	0.914	DDRGK domain-containing protein 1
10	9606.ENSP00000216037	0.912	X-box-binding protein 1
11	9606.ENSP00000267884	0.897	Signal recognition particle 14 kDa protein
12	9606.ENSP00000262584	0.843	60S ribosomal protein L8
13	9606.ENSP00000380982	0.834	Pumilio homolog 3
14	9606.ENSP00000359345	0.824	60S ribosomal protein L5
15	9606.ENSP00000346015	0.808	Ribosomal protein L27a
16	9606.ENSP00000420311	0.804	Ribosomal protein L23
17	9606.ENSP00000259469	0.803	60S ribosomal protein L35
18	9606.ENSP00000449328	0.802	60S acidic ribosomal protein P0
19	9606.ENSP00000354739	0.799	60S ribosomal protein L12
20	9606.ENSP00000346001	0.793	60S ribosomal protein L3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0060090	0.999	molecular adaptor activity
GO:0005515	0.977	protein binding
GO:0003824	0.491	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0051234	0.915	establishment of localization
GO:0006605	0.872	protein targeting
GO:0051668	0.796	localization within membrane
GO:0072657	0.732	protein localization to membrane
GO:0090150	0.690	establishment of protein localization to membrane
GO:0006612	0.679	protein targeting to membrane
GO:0065007	0.397	biological regulation
GO:0050789	0.388	regulation of biological process
GO:0006613	0.378	cotranslational protein targeting to membrane
GO:0050794	0.332	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.998	endoplasmic reticulum membrane
GO:0032991	0.993	protein-containing complex
GO:0098588	0.933	bounding membrane of organelle
GO:0005791	0.929	rough endoplasmic reticulum
GO:0030867	0.900	rough endoplasmic reticulum membrane
GO:0005829	0.750	cytosol
GO:0098796	0.683	membrane protein complex
GO:0140534	0.589	endoplasmic reticulum protein-containing complex
GO:0070013	0.545	intracellular organelle lumen
GO:1903561	0.458	extracellular vesicle
GO:0070062	0.451	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]