StarFunc result for job id P08243

User Input

>input (561 residues)
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGV
FAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFN
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPK
WINATDPSARTLTHYKSAVKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08243	1.000	1.000	4.074E-98	561	1.000	1.000	P08243.pdb.gz	ASNS_HUMAN Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS PE=1 SV=4
2	PDB:6gq3A	0.890	0.980	7.434E-76	509	0.906	0.998	6gq3A.pdb.gz	High-resolution crystal structure of human asparagine synthetase enables analysis of inhibitor binding and selectivity.
3	AFDB:P49078	0.850	0.818	1.194E-45	584	0.380	0.365	P49078.pdb.gz	ASNS1_ARATH Asparagine synthetase [glutamine-hydrolyzing] 1 OS=Arabidopsis thaliana OX=3702 GN=ASN1 PE=2 SV=2
4	AFDB:Q9LV77	0.826	0.802	2.628E-45	578	0.385	0.374	Q9LV77.pdb.gz	ASNS2_ARATH Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Arabidopsis thaliana OX=3702 GN=ASN2 PE=2 SV=1
5	AFDB:Q54MB4	0.877	0.883	5.785E-45	557	0.374	0.377	Q54MB4.pdb.gz	ASNS_DICDI Probable asparagine synthetase [glutamine-hydrolyzing] OS=Dictyostelium discoideum OX=44689 GN=asns PE=1 SV=1
6	AFDB:P22106	0.830	0.841	6.770E-44	554	0.364	0.368	P22106.pdb.gz	ASNB_ECOLI Asparagine synthetase B [glutamine-hydrolyzing] OS=Escherichia coli (strain K12) OX=83333 GN=asnB PE=1 SV=3
7	AFDB:P49090	0.864	0.848	7.221E-43	572	0.371	0.364	P49090.pdb.gz	ASNS2_YEAST Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ASN2 PE=1 SV=2
8	AFDB:P78753	0.857	0.863	1.260E-42	557	0.365	0.368	P78753.pdb.gz	ASNS_SCHPO Probable asparagine synthetase [glutamine-hydrolyzing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asn1 PE=1 SV=3
9	AFDB:P49089	0.860	0.844	1.776E-41	572	0.360	0.353	P49089.pdb.gz	ASNS1_YEAST Asparagine synthetase [glutamine-hydrolyzing] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ASN1 PE=1 SV=2
10	PDB:1ct9A	0.808	0.909	2.598E-39	497	0.355	0.400	1ct9A.pdb.gz	Three-dimensional structure of Escherichia coli asparagine synthetase B: a short journey from substrate to product.
11	AFDB:P9WN33	0.737	0.639	1.698E-28	652	0.267	0.230	P9WN33.pdb.gz	ASNH_MYCTU Putative asparagine synthetase [glutamine-hydrolyzing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=asnB PE=1 SV=1
12	AFDB:Q04489	0.675	0.719	2.500E-22	525	0.212	0.227	Q04489.pdb.gz	ASND1_YEAST Asparagine synthetase domain-containing protein YML096W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YML096W PE=1 SV=1
13	PDB:4amvA	0.275	0.257	8.151E-9	608	0.107	0.099	4amvA.pdb.gz	Glutamine Binding Opens the Ammonia Channel and Activates Glucosamine-6P Synthase
14	PDB:1ecfB	0.322	0.357	1.794E-8	500	0.105	0.118	1ecfB.pdb.gz	Crystal structure of glutamine phosphoribosylpyrophosphate amidotransferase from Escherichia coli.
15	PDB:1wxiA	0.175	0.324	1.419E-3	261	0.050	0.107	1wxiA.pdb.gz	Structures of Escherichia coli NAD Synthetase with Substrates and Products Reveal Mechanistic Rearrangements
16	PDB:3seqA	0.218	0.189	4.526E-3	661	0.096	0.082	3seqA.pdb.gz	Regulation of the intersubunit ammonia tunnel in Mycobacterium tuberculosis glutamine-dependent NAD+ synthetase.
17	PDB:1ni5A	0.168	0.212	6.873E-3	433	0.037	0.048	1ni5A.pdb.gz
18	PDB:2nz2A	0.163	0.218	7.542E-3	402	0.039	0.055	2nz2A.pdb.gz	Structure of human argininosuccinate synthetase.
19	PDB:2vxoB	0.253	0.221	8.275E-3	658	0.075	0.064	2vxoB.pdb.gz	Substrate Specificity and Oligomerization of Human Gmp Synthetase
20	PDB:1gpmA	0.238	0.263	9.963E-3	501	0.071	0.080	1gpmA.pdb.gz	The crystal structure of GMP synthetase reveals a novel catalytic triad and is a structural paradigm for two enzyme families.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08243	0.0	1174	561	1.000	1.000	ASNS_HUMAN Asparagine synthetase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=ASNS PE=1 SV=4
2	P49088	0.0	1115	561	0.936	0.936	ASNS_RAT Asparagine synthetase [glutamine-hydrolyzing] OS=Rattus norvegicus OX=10116 GN=Asns PE=2 SV=3
3	Q61024	0.0	1120	561	0.939	0.939	ASNS_MOUSE Asparagine synthetase [glutamine-hydrolyzing] OS=Mus musculus OX=10090 GN=Asns PE=1 SV=3
4	C9J057	2.86e-160	457	214	0.381	1.000	C9J057_HUMAN Asparagine synthetase (glutamine-hydrolyzing) (Fragment) OS=Homo sapiens OX=9606 GN=ASNS PE=1 SV=8
5	C9JT45	6.95e-119	350	162	0.289	1.000	C9JT45_HUMAN Asparagine synthetase (glutamine-hydrolyzing) (Fragment) OS=Homo sapiens OX=9606 GN=ASNS PE=1 SV=1
6	Q9LV77	1.76e-116	358	578	0.403	0.391	ASNS2_ARATH Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Arabidopsis thaliana OX=3702 GN=ASN2 PE=2 SV=1
7	P49078	1.58e-115	356	584	0.406	0.390	ASNS1_ARATH Asparagine synthetase [glutamine-hydrolyzing] 1 OS=Arabidopsis thaliana OX=3702 GN=ASN1 PE=2 SV=2
8	P22106	4.60e-107	333	554	0.385	0.390	ASNB_ECOLI Asparagine synthetase B [glutamine-hydrolyzing] OS=Escherichia coli (strain K12) OX=83333 GN=asnB PE=1 SV=3
9	Q54MB4	2.42e-104	327	557	0.383	0.386	ASNS_DICDI Probable asparagine synthetase [glutamine-hydrolyzing] OS=Dictyostelium discoideum OX=44689 GN=asns PE=1 SV=1
10	P49090	4.39e-94	300	572	0.392	0.385	ASNS2_YEAST Asparagine synthetase [glutamine-hydrolyzing] 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ASN2 PE=1 SV=2
11	P78753	2.02e-93	298	557	0.394	0.397	ASNS_SCHPO Probable asparagine synthetase [glutamine-hydrolyzing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asn1 PE=1 SV=3
12	P49089	1.04e-91	294	572	0.385	0.378	ASNS1_YEAST Asparagine synthetase [glutamine-hydrolyzing] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ASN1 PE=1 SV=2
13	C9JM09	1.65e-84	259	118	0.210	1.000	C9JM09_HUMAN Asparagine synthetase (glutamine-hydrolyzing) (Fragment) OS=Homo sapiens OX=9606 GN=ASNS PE=1 SV=8
14	P9WN33	6.15e-32	132	652	0.196	0.169	ASNH_MYCTU Putative asparagine synthetase [glutamine-hydrolyzing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=asnB PE=1 SV=1
15	Q04489	5.46e-15	80.1	525	0.219	0.234	ASND1_YEAST Asparagine synthetase domain-containing protein YML096W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YML096W PE=1 SV=1
16	Q21555	2.25e-07	55.8	475	0.171	0.202	Q21555_CAEEL Asparagine synthetase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M18.3 PE=1 SV=1
17	O74397	5.27e-06	51.6	548	0.098	0.100	ASND1_SCHPO Asparagine synthetase domain-containing protein C4F6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4F6.11c PE=3 SV=1
18	Q9LIL3	0.032	38.9	248	0.046	0.105	Q9LIL3_ARATH Aluminum induced protein with YGL and LRDR motifs OS=Arabidopsis thaliana OX=3702 GN=At3g22850 PE=1 SV=1
19	Q94BR2	0.065	37.7	234	0.029	0.068	Q94BR2_ARATH Aluminum induced protein with YGL and LRDR motifs OS=Arabidopsis thaliana OX=3702 GN=AILP1 PE=1 SV=1
20	Q0WVF5	0.10	38.1	847	0.052	0.034	MCM4_ARATH DNA replication licensing factor MCM4 OS=Arabidopsis thaliana OX=3702 GN=MCM4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00733 Asn_synthase	1.9e-81	286.1	Asparagine synthase
2	PF12481 DUF3700	0.0069	27.4	Aluminium induced protein
3	PF13522 GATase_6	4.3e-17	73.9	Glutamine amidotransferase domain
4	PF13537 GATase_7	3.6e-22	90.0	Glutamine amidotransferase domain
5	PF02540 NAD_synthase	1.6e+02	12.9	NAD synthase
6	PF06508 QueC	1.7e+02	13.1	Queuosine biosynthesis protein QueC
7	PF03054 tRNA_Me_trans	81	14.3	tRNA methyl transferase HUP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000175506

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361471	0.990	Argininosuccinate synthase
2	9606.ENSP00000336790	0.967	Cyclic AMP-dependent transcription factor ATF-4
3	9606.ENSP00000245206	0.961	Aspartate aminotransferase, mitochondrial
4	9606.ENSP00000264705	0.957	CAD protein
5	9606.ENSP00000305422	0.953	CCAAT/enhancer-binding protein beta
6	9606.ENSP00000359539	0.946	Aspartate aminotransferase, cytoplasmic
7	9606.ENSP00000373918	0.945	Glycine--tRNA ligase
8	9606.ENSP00000355493	0.932	Adenylosuccinate synthetase isozyme 2
9	9606.ENSP00000333019	0.929	Adenylosuccinate synthetase isozyme 1
10	9606.ENSP00000284000	0.925	CCAAT/enhancer-binding protein gamma
11	9606.ENSP00000303077	0.924	Putative aspartate aminotransferase, cytoplasmic 2
12	9606.ENSP00000263080	0.909	Aspartoacylase
13	9606.ENSP00000413064	0.907	N-acetylaspartate synthetase
14	9606.ENSP00000472474	0.904	L-amino-acid oxidase
15	9606.ENSP00000256854	0.881	Asparagine--tRNA ligase, cytoplasmic
16	9606.ENSP00000256383	0.873	Eukaryotic translation initiation factor 2 subunit 1
17	9606.ENSP00000355890	0.873	Bifunctional glutamate/proline--tRNA ligase
18	9606.ENSP00000261772	0.864	Alanine--tRNA ligase, cytoplasmic
19	9606.ENSP00000400057	0.859	Isoaspartyl peptidase/L-asparaginase
20	9606.ENSP00000364794	0.844	Isoleucine--tRNA ligase, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004066	0.998	asparagine synthase (glutamine-hydrolyzing) activity
GO:0042802	0.925	identical protein binding
GO:1901363	0.346	heterocyclic compound binding
GO:0097159	0.346	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0044238	0.992	primary metabolic process
GO:0009066	0.977	aspartate family amino acid metabolic process
GO:1901566	0.969	organonitrogen compound biosynthetic process
GO:1901607	0.961	alpha-amino acid biosynthetic process
GO:0050896	0.917	response to stimulus
GO:0009067	0.907	aspartate family amino acid biosynthetic process
GO:0006950	0.874	response to stress
GO:0033554	0.848	cellular response to stress
GO:0009605	0.841	response to external stimulus
GO:0071496	0.802	cellular response to external stimulus
GO:0007154	0.800	cell communication
GO:0009991	0.733	response to extracellular stimulus
GO:0031668	0.723	cellular response to extracellular stimulus
GO:0031669	0.684	cellular response to nutrient levels
GO:0065007	0.603	biological regulation
GO:0042594	0.597	response to starvation
GO:0050789	0.547	regulation of biological process
GO:0006528	0.510	asparagine metabolic process
GO:0050794	0.480	regulation of cellular process
GO:0006529	0.473	asparagine biosynthetic process
GO:0009267	0.418	cellular response to starvation
GO:0048518	0.316	positive regulation of biological process
GO:0042149	0.301	cellular response to glucose starvation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12228	0.998	ATP + H2O + L-aspartate + L-glutamine = AMP + diphosphate + H(+) + L-asparagine + L-glutamate
EC:6.3.5.4	0.998	asparagine synthase (glutamine-hydrolyzing).

[back to server]