StarFunc result for job id P08246

User Input

>input (267 residues)
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08246	1.000	1.000	5.921E-54	267	1.000	1.000	P08246.pdb.gz	ELNE_HUMAN Neutrophil elastase OS=Homo sapiens OX=9606 GN=ELANE PE=1 SV=1
2	PDB:5a09A	0.809	0.991	2.483E-42	218	0.813	0.995	5a09A.pdb.gz	Freezing the Bioactive Conformation to Boost Potency: The Identification of BAY 85-8501, a Selective and Potent Inhibitor of Human Neutrophil Elastase for Pulmonary Diseases.
3	AFDB:D4A488	0.838	0.826	2.416E-40	271	0.708	0.697	D4A488.pdb.gz	D4A488_RAT Elastase, neutrophil expressed OS=Rattus norvegicus OX=10116 GN=Elane PE=4 SV=1
4	AFDB:P24158	0.849	0.885	3.005E-35	256	0.491	0.512	P24158.pdb.gz	PRTN3_HUMAN Myeloblastin OS=Homo sapiens OX=9606 GN=PRTN3 PE=1 SV=3
5	AFDB:Q61096	0.829	0.870	1.027E-34	254	0.479	0.504	Q61096.pdb.gz	PRTN3_MOUSE Myeloblastin OS=Mus musculus OX=10090 GN=Prtn3 PE=1 SV=2
6	PDB:1fujA	0.800	0.965	5.441E-33	221	0.449	0.543	1fujA.pdb.gz	The crystal structure of PR3, a neutrophil serine proteinase antigen of Wegener's granulomatosis antibodies.
7	AFDB:P20160	0.818	0.869	8.174E-30	251	0.423	0.450	P20160.pdb.gz	CAP7_HUMAN Azurocidin OS=Homo sapiens OX=9606 GN=AZU1 PE=1 SV=3
8	AFDB:Q6UWY2	0.822	0.777	1.395E-27	283	0.352	0.332	Q6UWY2.pdb.gz	PRS57_HUMAN Serine protease 57 OS=Homo sapiens OX=9606 GN=PRSS57 PE=1 SV=2
9	PDB:1fy1A	0.788	0.931	6.606E-26	225	0.382	0.453	1fy1A.pdb.gz
10	PDB:4q7xA	0.797	0.903	4.936E-25	235	0.311	0.353	4q7xA.pdb.gz
11	AFDB:P11034	0.775	0.838	2.351E-24	246	0.315	0.341	P11034.pdb.gz	MCPT1_MOUSE Mast cell protease 1 OS=Mus musculus OX=10090 GN=Mcpt1 PE=1 SV=2
12	AFDB:P10144	0.765	0.825	2.940E-24	247	0.326	0.352	P10144.pdb.gz	GRAB_HUMAN Granzyme B OS=Homo sapiens OX=9606 GN=GZMB PE=1 SV=2
13	AFDB:P07288	0.782	0.799	3.476E-24	261	0.300	0.307	P07288.pdb.gz	KLK3_HUMAN Prostate-specific antigen OS=Homo sapiens OX=9606 GN=KLK3 PE=1 SV=2
14	AFDB:P51124	0.791	0.821	4.346E-24	257	0.307	0.319	P51124.pdb.gz	GRAM_HUMAN Granzyme M OS=Homo sapiens OX=9606 GN=GZMM PE=1 SV=2
15	PDB:5mt0A	0.758	0.876	4.556E-23	230	0.281	0.326	5mt0A.pdb.gz	Structure-Based Library Design and Fragment Screening for the Identification of Reversible Complement Factor D Protease Inhibitors.
16	PDB:2zghA	0.769	0.885	9.418E-23	231	0.288	0.333	2zghA.pdb.gz	Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
17	PDB:2a31A	0.754	0.897	1.245E-22	223	0.285	0.341	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
18	PDB:2a7jA	0.755	0.837	1.472E-22	240	0.337	0.375	2a7jA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
19	PDB:1fi8B	0.735	0.859	1.741E-22	227	0.277	0.326	1fi8B.pdb.gz
20	PDB:2ra3A	0.755	0.896	4.025E-22	224	0.277	0.330	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08246	0.0	535	267	1.000	1.000	ELNE_HUMAN Neutrophil elastase OS=Homo sapiens OX=9606 GN=ELANE PE=1 SV=1
2	D4A488	3.64e-126	361	271	0.670	0.661	D4A488_RAT Elastase, neutrophil expressed OS=Rattus norvegicus OX=10116 GN=Elane PE=4 SV=1
3	Q3UP87	4.56e-125	358	265	0.670	0.675	ELNE_MOUSE Neutrophil elastase OS=Mus musculus OX=10090 GN=Elane PE=1 SV=1
4	Q61096	2.52e-87	262	254	0.479	0.504	PRTN3_MOUSE Myeloblastin OS=Mus musculus OX=10090 GN=Prtn3 PE=1 SV=2
5	P24158	1.71e-84	254	256	0.461	0.480	PRTN3_HUMAN Myeloblastin OS=Homo sapiens OX=9606 GN=PRTN3 PE=1 SV=3
6	U3KPS2	1.47e-76	233	215	0.427	0.530	U3KPS2_HUMAN Myeloblastin OS=Homo sapiens OX=9606 GN=PRTN3 PE=1 SV=1
7	P20160	2.34e-59	191	251	0.393	0.418	CAP7_HUMAN Azurocidin OS=Homo sapiens OX=9606 GN=AZU1 PE=1 SV=3
8	Q6UWY2	1.02e-40	144	283	0.356	0.336	PRS57_HUMAN Serine protease 57 OS=Homo sapiens OX=9606 GN=PRSS57 PE=1 SV=2
9	P00772	1.18e-38	137	266	0.356	0.357	CELA1_PIG Chymotrypsin-like elastase family member 1 OS=Sus scrofa OX=9823 GN=CELA1 PE=1 SV=1
10	Q86SR2	1.43e-38	136	226	0.281	0.332	Q86SR2_HUMAN AZU1 protein (Fragment) OS=Homo sapiens OX=9606 GN=AZU1 PE=2 SV=1
11	P12544	4.94e-38	136	262	0.311	0.317	GRAA_HUMAN Granzyme A OS=Homo sapiens OX=9606 GN=GZMA PE=1 SV=2
12	P49864	6.15e-38	135	258	0.296	0.306	GRAK_RAT Granzyme K OS=Rattus norvegicus OX=10116 GN=Gzmk PE=1 SV=1
13	P11034	3.26e-37	133	246	0.303	0.329	MCPT1_MOUSE Mast cell protease 1 OS=Mus musculus OX=10090 GN=Mcpt1 PE=1 SV=2
14	Q9Z1D3	8.30e-37	132	238	0.315	0.353	Q9Z1D3_RAT Mast cell protease 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Mcpt3 PE=2 SV=1
15	P11032	1.50e-36	132	260	0.292	0.300	GRAA_MOUSE Granzyme A OS=Mus musculus OX=10090 GN=Gzma PE=1 SV=2
16	P00746	5.07e-36	130	253	0.303	0.320	CFAD_HUMAN Complement factor D OS=Homo sapiens OX=9606 GN=CFD PE=1 SV=5
17	P10144	5.28e-36	130	247	0.311	0.336	GRAB_HUMAN Granzyme B OS=Homo sapiens OX=9606 GN=GZMB PE=1 SV=2
18	P08311	5.93e-36	130	255	0.326	0.341	CATG_HUMAN Cathepsin G OS=Homo sapiens OX=9606 GN=CTSG PE=1 SV=2
19	P97592	7.09e-36	130	246	0.303	0.329	MCPT4_RAT Mast cell protease 4 OS=Rattus norvegicus OX=10116 GN=Mcpt4 PE=2 SV=1
20	P51124	7.78e-36	130	257	0.322	0.335	GRAM_HUMAN Granzyme M OS=Homo sapiens OX=9606 GN=GZMM PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	0.19	23.5	Domain of unknown function (DUF1986)
2	PF00089 Trypsin	1.1e-53	193.9	Trypsin
3	PF13365 Trypsin_2	1.1	21.7	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000466090

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000416066	0.996	Alpha-1-antitrypsin
2	9606.ENSP00000342082	0.994	Antileukoproteinase
3	9606.ENSP00000225275	0.971	Myeloperoxidase
4	9606.ENSP00000236826	0.971	Neutrophil collagenase
5	9606.ENSP00000323929	0.967	Alpha-2-macroglobulin
6	9606.ENSP00000322788	0.944	Interstitial collagenase
7	9606.ENSP00000260227	0.943	Matrilysin
8	9606.ENSP00000223642	0.932	Complement C5
9	9606.ENSP00000339328	0.921	Urokinase plasminogen activator surface receptor
10	9606.ENSP00000264187	0.918	Nidogen-1
11	9606.ENSP00000370115	0.901	Leukocyte elastase inhibitor
12	9606.ENSP00000351807	0.894	Elastin
13	9606.ENSP00000297435	0.893	Neutrophil defensin 4
14	9606.ENSP00000216336	0.877	Cathepsin G
15	9606.ENSP00000262865	0.843	Bactericidal permeability-increasing protein
16	9606.ENSP00000244336	0.840	Carcinoembryonic antigen related cell adhesion molecule family
17	9606.ENSP00000321853	0.819	Alpha-2-antiplasmin
18	9606.ENSP00000302324	0.812	Eosinophil cationic protein
19	9606.ENSP00000233997	0.801	Azurocidin
20	9606.ENSP00000296435	0.798	Cathelicidin antimicrobial peptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004252	0.999	serine-type endopeptidase activity
GO:0005515	0.985	protein binding
GO:0005539	0.331	glycosaminoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0002376	0.988	immune system process
GO:0065007	0.987	biological regulation
GO:0006952	0.987	defense response
GO:0044419	0.984	biological process involved in interspecies interaction between organisms
GO:0009605	0.984	response to external stimulus
GO:0009607	0.983	response to biotic stimulus
GO:0050789	0.982	regulation of biological process
GO:0043170	0.979	macromolecule metabolic process
GO:0001906	0.970	cell killing
GO:0006955	0.943	immune response
GO:0098542	0.940	defense response to other organism
GO:0019222	0.926	regulation of metabolic process
GO:0050794	0.913	regulation of cellular process
GO:0006807	0.905	nitrogen compound metabolic process
GO:0044238	0.897	primary metabolic process
GO:1901564	0.873	organonitrogen compound metabolic process
GO:0019730	0.865	antimicrobial humoral response
GO:0019538	0.863	protein metabolic process
GO:0048518	0.845	positive regulation of biological process
GO:0002252	0.757	immune effector process
GO:0060255	0.732	regulation of macromolecule metabolic process
GO:0051702	0.686	biological process involved in interaction with symbiont
GO:0010468	0.671	regulation of gene expression
GO:0009617	0.666	response to bacterium
GO:0002443	0.661	leukocyte mediated immunity
GO:0002444	0.654	myeloid leukocyte mediated immunity
GO:0048522	0.618	positive regulation of cellular process
GO:0051873	0.616	killing by host of symbiont cells
GO:0001909	0.598	leukocyte mediated cytotoxicity
GO:0048519	0.558	negative regulation of biological process
GO:0051716	0.498	cellular response to stimulus
GO:0051239	0.466	regulation of multicellular organismal process
GO:0010604	0.461	positive regulation of macromolecule metabolic process
GO:0006508	0.461	proteolysis
GO:0080090	0.423	regulation of primary metabolic process
GO:0031323	0.413	regulation of cellular metabolic process
GO:0042221	0.395	response to chemical
GO:0051171	0.392	regulation of nitrogen compound metabolic process
GO:0048583	0.382	regulation of response to stimulus
GO:0048523	0.380	negative regulation of cellular process
GO:0032501	0.378	multicellular organismal process
GO:0001817	0.332	regulation of cytokine production
GO:0071840	0.314	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.997	endomembrane system
GO:0030312	0.997	external encapsulating structure
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0031982	0.992	vesicle
GO:0062023	0.986	collagen-containing extracellular matrix
GO:0030141	0.982	secretory granule
GO:0005576	0.975	extracellular region
GO:0005764	0.964	lysosome
GO:0034774	0.948	secretory granule lumen
GO:0043230	0.946	extracellular organelle
GO:0065010	0.940	extracellular membrane-bounded organelle
GO:0005829	0.933	cytosol
GO:1903561	0.923	extracellular vesicle
GO:0005615	0.913	extracellular space
GO:0070062	0.886	extracellular exosome
GO:0032991	0.821	protein-containing complex
GO:0016020	0.772	membrane
GO:0042582	0.728	azurophil granule
GO:0009986	0.468	cell surface
GO:0005775	0.386	vacuolar lumen
GO:0035578	0.376	azurophil granule lumen
GO:0005886	0.373	plasma membrane
GO:0042581	0.338	specific granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	0.999	Serine endopeptidases.

[back to server]