StarFunc result for job id P08253

User Input

>input (660 residues)
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1gxdA	0.910	0.961	0.000	624	0.944	0.998	1gxdA.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
2	AFDB:P33434	0.980	0.977	0.000	662	0.959	0.956	P33434.pdb.gz	MMP2_MOUSE 72 kDa type IV collagenase OS=Mus musculus OX=10090 GN=Mmp2 PE=1 SV=1
3	AFDB:Q6DG10	0.920	0.924	0.000	657	0.718	0.721	Q6DG10.pdb.gz
4	AFDB:Q90611	0.968	0.964	0.000	663	0.823	0.819	Q90611.pdb.gz	MMP2_CHICK 72 kDa type IV collagenase OS=Gallus gallus OX=9031 GN=MMP2 PE=1 SV=1
5	AFDB:F1QC76	0.604	0.588	7.433E-85	680	0.477	0.463	F1QC76.pdb.gz
6	AFDB:B5X4C7	0.576	0.567	3.551E-84	671	0.474	0.466	B5X4C7.pdb.gz	B5X4C7_SALSA Matrix metalloproteinase-9 OS=Salmo salar OX=8030 GN=MMP9 PE=2 SV=1
7	AFDB:P14780	0.594	0.557	4.097E-82	707	0.474	0.443	P14780.pdb.gz	MMP9_HUMAN Matrix metalloproteinase-9 OS=Homo sapiens OX=9606 GN=MMP9 PE=1 SV=3
8	AFDB:P41245	0.759	0.693	5.060E-81	730	0.476	0.430	P41245.pdb.gz	MMP9_MOUSE Matrix metalloproteinase-9 OS=Mus musculus OX=10090 GN=Mmp9 PE=1 SV=2
9	AFDB:P50282	0.556	0.521	2.637E-78	708	0.465	0.434	P50282.pdb.gz	MMP9_RAT Matrix metalloproteinase-9 OS=Rattus norvegicus OX=10116 GN=Mmp9 PE=2 SV=1
10	AFDB:P45452	0.596	0.821	1.492E-50	471	0.326	0.456	P45452.pdb.gz	MMP13_HUMAN Collagenase 3 OS=Homo sapiens OX=9606 GN=MMP13 PE=1 SV=1
11	AFDB:P33435	0.605	0.837	1.764E-50	472	0.317	0.443	P33435.pdb.gz	MMP13_MOUSE Collagenase 3 OS=Mus musculus OX=10090 GN=Mmp13 PE=1 SV=1
12	PDB:1su3B	0.584	0.912	3.682E-46	416	0.288	0.457	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
13	PDB:2mzeA	0.317	0.789	2.032E-16	250	0.191	0.504	2mzeA.pdb.gz	Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
14	PDB:3lp9A	0.256	0.687	7.720E-11	227	0.061	0.176	3lp9A.pdb.gz	Crystal structure and functional insights of hemopexin fold protein from grass pea
15	PDB:1h8pA	0.088	0.472	8.797E-8	88	0.053	0.398	1h8pA.pdb.gz	Sperm Coating Mechanism from the 1.8 A Crystal Structure of Pdc-109-Phosphorylcholine Complex
16	PDB:4v6wAg	0.171	0.307	4.152E-6	318	0.039	0.082	4v6wAg.pdb.gz	Structures of the human and Drosophila 80S ribosome.
17	PDB:5c2vB	0.152	0.256	6.863E-6	352	0.027	0.051	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
18	PDB:7mq8LS	0.153	0.204	6.863E-6	453	0.050	0.073	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7d4iBE	0.161	0.126	8.116E-6	890	0.032	0.024	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
20	PDB:7zgrD	0.159	0.242	9.596E-6	395	0.030	0.051	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5X4C7	0.0	622	671	0.486	0.478	B5X4C7_SALSA Matrix metalloproteinase-9 OS=Salmo salar OX=8030 GN=MMP9 PE=2 SV=1
2	P08253	0.0	1368	660	1.000	1.000	MMP2_HUMAN 72 kDa type IV collagenase OS=Homo sapiens OX=9606 GN=MMP2 PE=1 SV=2
3	P14780	0.0	583	707	0.483	0.451	MMP9_HUMAN Matrix metalloproteinase-9 OS=Homo sapiens OX=9606 GN=MMP9 PE=1 SV=3
4	P33434	0.0	1292	662	0.959	0.956	MMP2_MOUSE 72 kDa type IV collagenase OS=Mus musculus OX=10090 GN=Mmp2 PE=1 SV=1
5	P33436	0.0	1290	662	0.955	0.952	MMP2_RAT 72 kDa type IV collagenase OS=Rattus norvegicus OX=10116 GN=Mmp2 PE=1 SV=2
6	P41245	0.0	584	730	0.479	0.433	MMP9_MOUSE Matrix metalloproteinase-9 OS=Mus musculus OX=10090 GN=Mmp9 PE=1 SV=2
7	P50282	0.0	551	708	0.462	0.431	MMP9_RAT Matrix metalloproteinase-9 OS=Rattus norvegicus OX=10116 GN=Mmp9 PE=2 SV=1
8	Q7SZM5	0.0	1014	657	0.715	0.718	Q7SZM5_DANRE 72 kDa type IV collagenase precursor OS=Danio rerio OX=7955 GN=wu:fk89d01 PE=2 SV=1
9	Q7T317	0.0	613	680	0.485	0.471	Q7T317_DANRE Matrix metalloproteinase 9 OS=Danio rerio OX=7955 GN=wu:fi98c09 PE=2 SV=1
10	Q90611	0.0	1138	663	0.823	0.819	MMP2_CHICK 72 kDa type IV collagenase OS=Gallus gallus OX=9031 GN=MMP2 PE=1 SV=1
11	O55123	2.04e-66	228	476	0.179	0.248	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
12	P45452	5.18e-63	218	471	0.170	0.238	MMP13_HUMAN Collagenase 3 OS=Homo sapiens OX=9606 GN=MMP13 PE=1 SV=1
13	P28862	1.56e-62	217	477	0.176	0.243	MMP3_MOUSE Stromelysin-1 OS=Mus musculus OX=10090 GN=Mmp3 PE=2 SV=2
14	P03957	5.28e-62	216	475	0.180	0.251	MMP3_RAT Stromelysin-1 OS=Rattus norvegicus OX=10116 GN=Mmp3 PE=1 SV=1
15	P03956	7.90e-62	215	469	0.173	0.243	MMP1_HUMAN Interstitial collagenase OS=Homo sapiens OX=9606 GN=MMP1 PE=1 SV=3
16	Q9DEE0	9.30e-62	215	475	0.174	0.242	Q9DEE0_ONCMY Matrix metalloproteinase OS=Oncorhynchus mykiss OX=8022 GN=mmp PE=2 SV=1
17	B5X4P7	8.97e-61	212	473	0.164	0.228	B5X4P7_SALSA Collagenase 3 OS=Salmo salar OX=8030 GN=MMP13 PE=2 SV=1
18	P22894	3.63e-60	210	467	0.176	0.248	MMP8_HUMAN Neutrophil collagenase OS=Homo sapiens OX=9606 GN=MMP8 PE=1 SV=1
19	P23097	7.13e-60	209	466	0.167	0.236	MMP13_RAT Collagenase 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Mmp13 PE=1 SV=1
20	P33435	8.07e-59	207	472	0.165	0.231	MMP13_MOUSE Collagenase 3 OS=Mus musculus OX=10090 GN=Mmp13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01400 Astacin	24	16.0	Astacin (Peptidase family M12A)
2	PF00040 fn2	9.7e-49	174.5	Fibronectin type II domain
3	PF00045 Hemopexin	7.3e-41	149.2	Hemopexin
4	PF00413 Peptidase_M10	5e-65	229.7	Matrixin
5	PF10462 Peptidase_M66	3.3e+02	11.6	Peptidase M66
6	PF01471 PG_binding_1	0.0014	30.1	Putative peptidoglycan binding domain
7	PF13582 Reprolysin_3	1.3e+02	14.4	Metallo-peptidase family M12B Reprolysin-like
8	PF13583 Reprolysin_4	4e+02	12.0	Metallo-peptidase family M12B Reprolysin-like
9	PF13688 Reprolysin_5	1.8e+02	13.6	Metallo-peptidase family M12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000218388	0.999	Metalloproteinase inhibitor 1
2	9606.ENSP00000262768	0.999	Metalloproteinase inhibitor 2
3	9606.ENSP00000266085	0.998	Metalloproteinase inhibitor 3
4	9606.ENSP00000052754	0.991	Decorin
5	9606.ENSP00000347665	0.991	Collagen alpha-1(XVIII) chain
6	9606.ENSP00000221930	0.988	Transforming growth factor beta-1
7	9606.ENSP00000478570	0.984	Vascular endothelial growth factor A
8	9606.ENSP00000264657	0.975	Signal transducer and activator of transcription 3
9	9606.ENSP00000362108	0.973	Neutrophil gelatinase-associated lipocalin
10	9606.ENSP00000355751	0.971	Thrombospondin-2
11	9606.ENSP00000385675	0.971	Interleukin-6
12	9606.ENSP00000264498	0.969	Fibroblast growth factor 2
13	9606.ENSP00000225964	0.967	Collagen alpha-1(I) chain
14	9606.ENSP00000387356	0.967	Aggrecan core protein
15	9606.ENSP00000222390	0.961	Hepatocyte growth factor
16	9606.ENSP00000367202	0.961	Reversion-inducing cysteine-rich protein with Kazal motifs
17	9606.ENSP00000362680	0.960	Proto-oncogene tyrosine-protein kinase Src
18	9606.ENSP00000302665	0.959	Insulin-like growth factor I
19	9606.ENSP00000412237	0.958	Interleukin-10
20	9606.ENSP00000260356	0.956	Thrombospondin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0004222	1.000	metalloendopeptidase activity
GO:0005515	0.977	protein binding
GO:0043167	0.889	ion binding
GO:0046872	0.882	metal ion binding
GO:0017171	0.855	serine hydrolase activity
GO:0004252	0.852	serine-type endopeptidase activity
GO:0008270	0.851	zinc ion binding
GO:0044877	0.402	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048856	0.983	anatomical structure development
GO:0032501	0.979	multicellular organismal process
GO:0051716	0.979	cellular response to stimulus
GO:0008152	0.959	metabolic process
GO:0032963	0.942	collagen metabolic process
GO:0048518	0.928	positive regulation of biological process
GO:0007275	0.928	multicellular organism development
GO:0007165	0.909	signal transduction
GO:0042221	0.897	response to chemical
GO:0048522	0.896	positive regulation of cellular process
GO:0048731	0.894	system development
GO:0009653	0.882	anatomical structure morphogenesis
GO:0030154	0.878	cell differentiation
GO:0071840	0.870	cellular component organization or biogenesis
GO:0016043	0.846	cellular component organization
GO:0071704	0.820	organic substance metabolic process
GO:0009628	0.815	response to abiotic stimulus
GO:0048519	0.804	negative regulation of biological process
GO:0044238	0.790	primary metabolic process
GO:0008284	0.763	positive regulation of cell population proliferation
GO:0006950	0.747	response to stress
GO:0006807	0.729	nitrogen compound metabolic process
GO:1904705	0.717	regulation of vascular associated smooth muscle cell proliferation
GO:0072359	0.714	circulatory system development
GO:0048583	0.712	regulation of response to stimulus
GO:0007492	0.712	endoderm development
GO:0009719	0.708	response to endogenous stimulus
GO:0043170	0.700	macromolecule metabolic process
GO:0019222	0.689	regulation of metabolic process
GO:0030198	0.682	extracellular matrix organization
GO:0010033	0.678	response to organic substance
GO:0007166	0.673	cell surface receptor signaling pathway
GO:1901564	0.660	organonitrogen compound metabolic process
GO:0051239	0.641	regulation of multicellular organismal process
GO:0060255	0.626	regulation of macromolecule metabolic process
GO:0048513	0.621	animal organ development
GO:0048523	0.612	negative regulation of cellular process
GO:0048646	0.607	anatomical structure formation involved in morphogenesis
GO:0019538	0.604	protein metabolic process
GO:1901700	0.590	response to oxygen-containing compound
GO:0048661	0.578	positive regulation of smooth muscle cell proliferation
GO:0051171	0.552	regulation of nitrogen compound metabolic process
GO:0080090	0.523	regulation of primary metabolic process
GO:0070887	0.485	cellular response to chemical stimulus
GO:0009056	0.482	catabolic process
GO:0009314	0.456	response to radiation
GO:0023051	0.455	regulation of signaling
GO:0010646	0.453	regulation of cell communication
GO:0050793	0.445	regulation of developmental process
GO:0031323	0.434	regulation of cellular metabolic process
GO:0009966	0.433	regulation of signal transduction
GO:0071214	0.414	cellular response to abiotic stimulus
GO:0010243	0.412	response to organonitrogen compound
GO:0000003	0.396	reproduction
GO:0048584	0.368	positive regulation of response to stimulus
GO:0051246	0.368	regulation of protein metabolic process
GO:0030334	0.365	regulation of cell migration
GO:0048870	0.364	cell motility
GO:1901652	0.350	response to peptide
GO:0009893	0.349	positive regulation of metabolic process
GO:0007167	0.340	enzyme-linked receptor protein signaling pathway
GO:0007169	0.334	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009790	0.330	embryo development
GO:0030335	0.326	positive regulation of cell migration
GO:0010941	0.313	regulation of cell death
GO:0009605	0.308	response to external stimulus
GO:0006508	0.308	proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0005615	0.999	extracellular space
GO:0005737	0.975	cytoplasm
GO:0043229	0.962	intracellular organelle
GO:0016020	0.838	membrane
GO:0043227	0.813	membrane-bounded organelle
GO:0043231	0.779	intracellular membrane-bounded organelle
GO:0043233	0.716	organelle lumen
GO:0031012	0.707	extracellular matrix
GO:0070013	0.697	intracellular organelle lumen
GO:0062023	0.647	collagen-containing extracellular matrix
GO:0005886	0.491	plasma membrane
GO:0031982	0.352	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.
EC:3.4.21.-	0.852	Serine endopeptidases.

[back to server]