StarFunc result for job id P08254

User Input

>input (477 residues)
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08254	1.000	1.000	1.332E-100	477	1.000	1.000	P08254.pdb.gz	MMP3_HUMAN Stromelysin-1 OS=Homo sapiens OX=9606 GN=MMP3 PE=1 SV=2
2	AFDB:P03957	0.927	0.930	8.687E-82	475	0.751	0.754	P03957.pdb.gz	MMP3_RAT Stromelysin-1 OS=Rattus norvegicus OX=10116 GN=Mmp3 PE=1 SV=1
3	AFDB:P09238	0.887	0.889	2.160E-81	476	0.782	0.784	P09238.pdb.gz	MMP10_HUMAN Stromelysin-2 OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1
4	AFDB:P28862	0.802	0.802	1.634E-79	477	0.771	0.771	P28862.pdb.gz	MMP3_MOUSE Stromelysin-1 OS=Mus musculus OX=10090 GN=Mmp3 PE=2 SV=2
5	AFDB:O55123	0.904	0.906	1.016E-76	476	0.702	0.704	O55123.pdb.gz	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
6	AFDB:P39900	0.508	0.516	2.686E-65	470	0.499	0.506	P39900.pdb.gz	MMP12_HUMAN Macrophage metalloelastase OS=Homo sapiens OX=9606 GN=MMP12 PE=1 SV=1
7	AFDB:P22894	0.490	0.500	1.445E-63	467	0.501	0.512	P22894.pdb.gz	MMP8_HUMAN Neutrophil collagenase OS=Homo sapiens OX=9606 GN=MMP8 PE=1 SV=1
8	AFDB:Q9H306	0.485	0.453	2.702E-63	513	0.495	0.460	Q9H306.pdb.gz	MMP27_HUMAN Matrix metalloproteinase-27 OS=Homo sapiens OX=9606 GN=MMP27 PE=1 SV=2
9	AFDB:P03956	0.496	0.504	9.454E-63	469	0.522	0.531	P03956.pdb.gz	MMP1_HUMAN Interstitial collagenase OS=Homo sapiens OX=9606 GN=MMP1 PE=1 SV=3
10	AFDB:P45452	0.462	0.468	1.982E-62	471	0.488	0.495	P45452.pdb.gz	MMP13_HUMAN Collagenase 3 OS=Homo sapiens OX=9606 GN=MMP13 PE=1 SV=1
11	PDB:1su3B	0.439	0.502	1.405E-59	416	0.503	0.577	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
12	PDB:1gxdA	0.435	0.336	2.473E-41	624	0.430	0.329	1gxdA.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
13	PDB:2mzeA	0.434	0.794	1.707E-22	250	0.256	0.488	2mzeA.pdb.gz	Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
14	PDB:3lp9A	0.350	0.699	1.060E-10	227	0.086	0.181	3lp9A.pdb.gz	Crystal structure and functional insights of hemopexin fold protein from grass pea
15	PDB:7d5sBE	0.216	0.136	8.538E-7	865	0.061	0.034	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:1af0A	0.243	0.247	2.005E-6	470	0.080	0.081	1af0A.pdb.gz	Kinetic characterization of the serralysins: a divergent catalytic mechanism pertaining to astacin-type metalloproteases.
17	PDB:1nr0A	0.220	0.180	2.005E-6	610	0.031	0.025	1nr0A.pdb.gz
18	PDB:1aklA	0.247	0.251	3.162E-6	470	0.088	0.089	1aklA.pdb.gz	Crystal structure of the unliganded alkaline protease from Pseudomonas aeruginosa IFO3080 and its conformational changes on ligand binding.
19	PDB:7zgrD	0.200	0.234	3.162E-6	395	0.042	0.051	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
20	PDB:7mq8LU	0.214	0.226	3.971E-6	445	0.044	0.047	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55123	0.0	712	476	0.715	0.716	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
2	P03956	0.0	520	469	0.520	0.529	MMP1_HUMAN Interstitial collagenase OS=Homo sapiens OX=9606 GN=MMP1 PE=1 SV=3
3	P03957	0.0	757	475	0.751	0.754	MMP3_RAT Stromelysin-1 OS=Rattus norvegicus OX=10116 GN=Mmp3 PE=1 SV=1
4	P08254	0.0	986	477	1.000	1.000	MMP3_HUMAN Stromelysin-1 OS=Homo sapiens OX=9606 GN=MMP3 PE=1 SV=2
5	P09238	0.0	762	476	0.782	0.784	MMP10_HUMAN Stromelysin-2 OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1
6	P28862	0.0	784	477	0.771	0.771	MMP3_MOUSE Stromelysin-1 OS=Mus musculus OX=10090 GN=Mmp3 PE=2 SV=2
7	P39900	2.65e-173	497	470	0.516	0.523	MMP12_HUMAN Macrophage metalloelastase OS=Homo sapiens OX=9606 GN=MMP12 PE=1 SV=1
8	P22894	2.77e-171	491	467	0.491	0.501	MMP8_HUMAN Neutrophil collagenase OS=Homo sapiens OX=9606 GN=MMP8 PE=1 SV=1
9	P45452	8.00e-169	486	471	0.495	0.501	MMP13_HUMAN Collagenase 3 OS=Homo sapiens OX=9606 GN=MMP13 PE=1 SV=1
10	P33435	8.41e-167	480	472	0.493	0.498	MMP13_MOUSE Collagenase 3 OS=Mus musculus OX=10090 GN=Mmp13 PE=1 SV=1
11	Q9H306	1.81e-166	481	513	0.514	0.478	MMP27_HUMAN Matrix metalloproteinase-27 OS=Homo sapiens OX=9606 GN=MMP27 PE=1 SV=2
12	P23097	6.26e-166	478	466	0.478	0.489	MMP13_RAT Collagenase 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Mmp13 PE=1 SV=1
13	O70138	8.96e-166	478	465	0.486	0.499	MMP8_MOUSE Neutrophil collagenase OS=Mus musculus OX=10090 GN=Mmp8 PE=2 SV=2
14	O88766	1.56e-164	474	466	0.491	0.502	MMP8_RAT Neutrophil collagenase OS=Rattus norvegicus OX=10116 GN=Mmp8 PE=2 SV=1
15	B5X4P7	4.91e-152	443	473	0.468	0.471	B5X4P7_SALSA Collagenase 3 OS=Salmo salar OX=8030 GN=MMP13 PE=2 SV=1
16	Q9DEE0	1.23e-151	442	475	0.474	0.476	Q9DEE0_ONCMY Matrix metalloproteinase OS=Oncorhynchus mykiss OX=8022 GN=mmp PE=2 SV=1
17	Q9EPL5	1.78e-151	441	464	0.470	0.483	MMP1A_MOUSE Interstitial collagenase A OS=Mus musculus OX=10090 GN=Mmp1a PE=2 SV=1
18	P34960	4.25e-147	430	473	0.488	0.493	MMP12_MOUSE Macrophage metalloelastase OS=Mus musculus OX=10090 GN=Mmp12 PE=1 SV=3
19	P57748	9.68e-145	424	482	0.476	0.471	MMP20_MOUSE Matrix metalloproteinase-20 OS=Mus musculus OX=10090 GN=Mmp20 PE=2 SV=1
20	Q63341	5.54e-144	422	465	0.463	0.475	MMP12_RAT Macrophage metalloelastase OS=Rattus norvegicus OX=10116 GN=Mmp12 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01400 Astacin	3.7	18.6	Astacin (Peptidase family M12A)
2	PF16313 DUF4953	29	15.3	Met-zincin
3	PF00045 Hemopexin	1.5e-48	173.8	Hemopexin
4	PF00413 Peptidase_M10	4.5e-61	216.8	Matrixin
5	PF01471 PG_binding_1	8.2e-07	40.4	Putative peptidoglycan binding domain
6	PF13574 Reprolysin_2	9.2e+02	11.1	Metallo-peptidase family M12B Reprolysin-like
7	PF13582 Reprolysin_3	50	15.8	Metallo-peptidase family M12B Reprolysin-like
8	PF13583 Reprolysin_4	27	15.9	Metallo-peptidase family M12B Reprolysin-like
9	PF13688 Reprolysin_5	2e+02	13.5	Metallo-peptidase family M12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299855

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000218388	0.999	Metalloproteinase inhibitor 1
2	9606.ENSP00000387356	0.986	Aggrecan core protein
3	9606.ENSP00000378517	0.984	Osteopontin
4	9606.ENSP00000308938	0.980	Plasminogen
5	9606.ENSP00000385675	0.977	Interleukin-6
6	9606.ENSP00000052754	0.967	Decorin
7	9606.ENSP00000262768	0.966	Metalloproteinase inhibitor 2
8	9606.ENSP00000261769	0.965	Cadherin-1
9	9606.ENSP00000478570	0.965	Vascular endothelial growth factor A
10	9606.ENSP00000264657	0.964	Signal transducer and activator of transcription 3
11	9606.ENSP00000264498	0.960	Fibroblast growth factor 2
12	9606.ENSP00000412237	0.959	Interleukin-10
13	9606.ENSP00000344456	0.958	Catenin beta-1
14	9606.ENSP00000344192	0.955	Interleukin-17A
15	9606.ENSP00000322788	0.953	Interstitial collagenase
16	9606.ENSP00000221930	0.952	Transforming growth factor beta-1
17	9606.ENSP00000222390	0.951	Hepatocyte growth factor
18	9606.ENSP00000215781	0.944	Oncostatin-M
19	9606.ENSP00000331210	0.943	Brevican core protein
20	9606.ENSP00000230990	0.941	Proheparin-binding EGF-like growth factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0004222	1.000	metalloendopeptidase activity
GO:0017171	0.999	serine hydrolase activity
GO:0008236	0.977	serine-type peptidase activity
GO:0004252	0.969	serine-type endopeptidase activity
GO:0005515	0.962	protein binding
GO:0046872	0.624	metal ion binding
GO:0008270	0.580	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.990	response to stimulus
GO:0050789	0.987	regulation of biological process
GO:0008152	0.986	metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0019222	0.964	regulation of metabolic process
GO:0032963	0.949	collagen metabolic process
GO:0071704	0.948	organic substance metabolic process
GO:0043062	0.945	extracellular structure organization
GO:0048522	0.941	positive regulation of cellular process
GO:0042221	0.938	response to chemical
GO:0030198	0.936	extracellular matrix organization
GO:0022411	0.930	cellular component disassembly
GO:0022617	0.914	extracellular matrix disassembly
GO:0044238	0.912	primary metabolic process
GO:0006807	0.911	nitrogen compound metabolic process
GO:0043170	0.909	macromolecule metabolic process
GO:1901564	0.904	organonitrogen compound metabolic process
GO:0019538	0.882	protein metabolic process
GO:0048519	0.862	negative regulation of biological process
GO:0006508	0.825	proteolysis
GO:0051716	0.824	cellular response to stimulus
GO:0031323	0.816	regulation of cellular metabolic process
GO:0048523	0.723	negative regulation of cellular process
GO:0048583	0.697	regulation of response to stimulus
GO:0070887	0.697	cellular response to chemical stimulus
GO:0010033	0.691	response to organic substance
GO:1901700	0.649	response to oxygen-containing compound
GO:0032501	0.630	multicellular organismal process
GO:0009892	0.610	negative regulation of metabolic process
GO:0048856	0.599	anatomical structure development
GO:0009628	0.594	response to abiotic stimulus
GO:0009056	0.535	catabolic process
GO:1904645	0.480	response to amyloid-beta
GO:0051239	0.461	regulation of multicellular organismal process
GO:0040012	0.422	regulation of locomotion
GO:0030334	0.407	regulation of cell migration
GO:0060255	0.405	regulation of macromolecule metabolic process
GO:0006950	0.402	response to stress
GO:1901699	0.401	cellular response to nitrogen compound
GO:0007275	0.398	multicellular organism development
GO:0023051	0.332	regulation of signaling
GO:0010646	0.332	regulation of cell communication
GO:0080134	0.319	regulation of response to stress
GO:0104004	0.309	cellular response to environmental stimulus
GO:0009966	0.309	regulation of signal transduction
GO:0009605	0.305	response to external stimulus
GO:0009893	0.303	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0071944	0.914	cell periphery
GO:0043227	0.841	membrane-bounded organelle
GO:0005622	0.801	intracellular anatomical structure
GO:0043229	0.662	intracellular organelle
GO:0043231	0.604	intracellular membrane-bounded organelle
GO:0005737	0.592	cytoplasm
GO:0070013	0.401	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.
EC:3.4.21.-	0.969	Serine endopeptidases.

[back to server]