StarFunc result for job id P08476

User Input

>input (426 residues)
MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKK
HILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT
SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQK
HPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDV
RIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQS
EDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAG
TSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV
EECGCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D1W7	0.907	0.907	3.870E-75	426	1.000	1.000	A4D1W7.pdb.gz	A4D1W7_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=1
2	PDB:5hlyA	0.680	0.964	3.429E-51	299	0.692	0.987	5hlyA.pdb.gz
3	AFDB:Q8QGE3	0.460	0.495	9.041E-45	395	0.549	0.592	Q8QGE3.pdb.gz	Q8QGE3_DANRE Activin beta A subunit OS=Danio rerio OX=7955 GN=actba PE=2 SV=1
4	AFDB:Q91350	0.445	0.505	1.435E-39	370	0.420	0.484	Q91350.pdb.gz	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
5	AFDB:P17491	0.405	0.418	1.167E-36	411	0.411	0.426	P17491.pdb.gz	INHBB_RAT Inhibin beta B chain OS=Rattus norvegicus OX=10116 GN=Inhbb PE=2 SV=2
6	AFDB:P27093	0.393	0.424	7.556E-36	391	0.415	0.453	P27093.pdb.gz	INHBB_CHICK Inhibin beta B chain OS=Gallus gallus OX=9031 GN=INHBB PE=2 SV=2
7	AFDB:P55103	0.384	0.457	3.646E-27	352	0.308	0.372	P55103.pdb.gz	INHBC_HUMAN Inhibin beta C chain OS=Homo sapiens OX=9606 GN=INHBC PE=2 SV=1
8	AFDB:P58166	0.358	0.430	4.842E-25	350	0.265	0.323	P58166.pdb.gz	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
9	AFDB:O61643	0.431	0.221	1.548E-22	946	0.261	0.117	O61643.pdb.gz	INHB_DROME Inhibin beta chain OS=Drosophila melanogaster OX=7227 GN=Actbeta PE=1 SV=2
10	AFDB:C8C060	0.276	0.293	1.937E-21	396	0.232	0.250	C8C060.pdb.gz	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
11	AFDB:A0A024RB20	0.481	0.498	8.081E-21	407	0.272	0.285	A0A024RB20.pdb.gz
12	PDB:5ntuA	0.269	0.351	3.386E-17	308	0.211	0.292	5ntuA.pdb.gz
13	PDB:5nxsA	0.326	0.427	2.202E-15	290	0.204	0.300	5nxsA.pdb.gz
14	PDB:6umxA	0.231	0.328	5.627E-14	279	0.192	0.294	6umxA.pdb.gz
15	PDB:3rjrC	0.234	0.283	5.945E-14	343	0.207	0.257	3rjrC.pdb.gz
16	PDB:5ffoG	0.229	0.315	7.823E-14	297	0.195	0.279	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
17	PDB:5vqfB	0.236	0.304	1.990E-13	320	0.204	0.272	5vqfB.pdb.gz
18	PDB:7y1rB	0.229	0.304	8.302E-13	308	0.200	0.276	7y1rB.pdb.gz
19	PDB:5nxsB	0.276	0.415	5.677E-12	251	0.183	0.311	5nxsB.pdb.gz
20	PDB:1m4uA	0.134	0.267	6.273E-2	199	0.045	0.095	1m4uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D1W7	0.0	883	426	1.000	1.000	A4D1W7_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=1
2	P07995	0.0	854	425	0.962	0.965	INHBA_BOVIN Inhibin beta A chain OS=Bos taurus OX=9913 GN=INHBA PE=1 SV=2
3	P08476	0.0	883	426	1.000	1.000	INHBA_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=2
4	P18331	0.0	837	424	0.960	0.965	INHBA_RAT Inhibin beta A chain OS=Rattus norvegicus OX=10116 GN=Inhba PE=2 SV=1
5	Q04998	0.0	848	424	0.960	0.965	INHBA_MOUSE Inhibin beta A chain OS=Mus musculus OX=10090 GN=Inhba PE=1 SV=1
6	Q8QGE3	5.27e-158	453	395	0.542	0.585	Q8QGE3_DANRE Activin beta A subunit OS=Danio rerio OX=7955 GN=actba PE=2 SV=1
7	Q91350	7.38e-112	335	370	0.406	0.468	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
8	P09529	4.43e-111	334	407	0.401	0.420	INHBB_HUMAN Inhibin beta B chain OS=Homo sapiens OX=9606 GN=INHBB PE=1 SV=2
9	P17491	2.80e-108	327	411	0.399	0.414	INHBB_RAT Inhibin beta B chain OS=Rattus norvegicus OX=10116 GN=Inhbb PE=2 SV=2
10	P27093	2.93e-108	326	391	0.401	0.437	INHBB_CHICK Inhibin beta B chain OS=Gallus gallus OX=9031 GN=INHBB PE=2 SV=2
11	Q04999	3.08e-108	327	411	0.399	0.414	INHBB_MOUSE Inhibin beta B chain OS=Mus musculus OX=10090 GN=Inhbb PE=2 SV=4
12	Q91752	2.68e-62	199	135	0.228	0.719	Q91752_XENLA Activin A subunit OS=Xenopus laevis OX=8355 GN=Activin A PE=4 SV=1
13	P55103	2.14e-61	204	352	0.296	0.358	INHBC_HUMAN Inhibin beta C chain OS=Homo sapiens OX=9606 GN=INHBC PE=2 SV=1
14	P58166	5.09e-50	174	350	0.284	0.346	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
15	O61643	9.89e-32	130	946	0.254	0.114	INHB_DROME Inhibin beta chain OS=Drosophila melanogaster OX=7227 GN=Actbeta PE=1 SV=2
16	C8C060	2.54e-30	122	396	0.254	0.273	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
17	P12643	2.54e-30	122	396	0.254	0.273	BMP2_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1
18	P21274	4.43e-30	122	394	0.230	0.249	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
19	P49001	1.83e-29	120	393	0.230	0.249	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
20	O18836	4.22e-28	116	375	0.254	0.288	GDF8_BOVIN Growth/differentiation factor 8 OS=Bos taurus OX=9913 GN=MSTN PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	1.5e-05	36.4	TGF-beta propeptide
2	PF00019 TGF_beta	2.6e-27	107.1	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003813

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000013426	0.996	Follistatin
2	61853.ENSNLEP00000006554	0.994	Serine/threonine-protein kinase receptor
3	61853.ENSNLEP00000011049	0.992	Serine/threonine-protein kinase receptor
4	61853.ENSNLEP00000011633	0.941	Inhibin alpha chain
5	61853.ENSNLEP00000000962	0.933	Receptor protein serine/threonine kinase
6	61853.ENSNLEP00000001091	0.860	Inhibin, beta B
7	61853.ENSNLEP00000021570	0.846	Receptor protein serine/threonine kinase
8	61853.ENSNLEP00000020116	0.822	Transforming growth factor, beta 3
9	61853.ENSNLEP00000016659	0.810	Transforming growth factor, beta 1
10	61853.ENSNLEP00000019553	0.807	Nodal growth differentiation factor
11	61853.ENSNLEP00000001001	0.767	Serine/threonine-protein kinase receptor
12	61853.ENSNLEP00000013966	0.758	Mothers against decapentaplegic homolog
13	61853.ENSNLEP00000015776	0.717	Mothers against decapentaplegic homolog
14	61853.ENSNLEP00000021573	0.705	Serine/threonine-protein kinase receptor
15	61853.ENSNLEP00000014415	0.676	Mothers against decapentaplegic homolog
16	61853.ENSNLEP00000021711	0.672	Follicle stimulating hormone, beta polypeptide
17	61853.ENSNLEP00000021247	0.665	Endoglin
18	61853.ENSNLEP00000020704	0.664	Receptor protein serine/threonine kinase
19	61853.ENSNLEP00000018653	0.662	Immunoglobulin superfamily, member 1
20	61853.ENSNLEP00000017688	0.637	Major facilitator superfamily domain containing 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.995	signaling receptor binding
GO:0030545	0.876	signaling receptor regulator activity
GO:0048018	0.843	receptor ligand activity
GO:0042802	0.413	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.990	cellular process
GO:0048856	0.990	anatomical structure development
GO:0032501	0.989	multicellular organismal process
GO:0048522	0.988	positive regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0019222	0.986	regulation of metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0051239	0.972	regulation of multicellular organismal process
GO:0007275	0.971	multicellular organism development
GO:0080090	0.961	regulation of primary metabolic process
GO:0009893	0.961	positive regulation of metabolic process
GO:0048519	0.958	negative regulation of biological process
GO:0048513	0.954	animal organ development
GO:0048731	0.952	system development
GO:0071704	0.941	organic substance metabolic process
GO:0030154	0.923	cell differentiation
GO:0009966	0.920	regulation of signal transduction
GO:0010604	0.917	positive regulation of macromolecule metabolic process
GO:0009889	0.916	regulation of biosynthetic process
GO:0044238	0.906	primary metabolic process
GO:0010468	0.898	regulation of gene expression
GO:0051241	0.889	negative regulation of multicellular organismal process
GO:0051093	0.887	negative regulation of developmental process
GO:0051716	0.877	cellular response to stimulus
GO:0044237	0.850	cellular metabolic process
GO:0051174	0.846	regulation of phosphorus metabolic process
GO:0007154	0.842	cell communication
GO:0031326	0.836	regulation of cellular biosynthetic process
GO:0007165	0.829	signal transduction
GO:0006807	0.822	nitrogen compound metabolic process
GO:0048523	0.822	negative regulation of cellular process
GO:0031325	0.812	positive regulation of cellular metabolic process
GO:2000026	0.787	regulation of multicellular organismal development
GO:0023056	0.777	positive regulation of signaling
GO:0043170	0.765	macromolecule metabolic process
GO:0051173	0.759	positive regulation of nitrogen compound metabolic process
GO:0010647	0.757	positive regulation of cell communication
GO:0045595	0.756	regulation of cell differentiation
GO:0051252	0.755	regulation of RNA metabolic process
GO:2001141	0.753	regulation of RNA biosynthetic process
GO:1903506	0.728	regulation of nucleic acid-templated transcription
GO:0006355	0.723	regulation of DNA-templated transcription
GO:0009891	0.721	positive regulation of biosynthetic process
GO:0007167	0.713	enzyme-linked receptor protein signaling pathway
GO:0051240	0.703	positive regulation of multicellular organismal process
GO:0009653	0.700	anatomical structure morphogenesis
GO:0006357	0.697	regulation of transcription by RNA polymerase II
GO:0009719	0.693	response to endogenous stimulus
GO:0045893	0.683	positive regulation of DNA-templated transcription
GO:0009888	0.605	tissue development
GO:0048584	0.598	positive regulation of response to stimulus
GO:0051094	0.577	positive regulation of developmental process
GO:0007178	0.577	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071495	0.531	cellular response to endogenous stimulus
GO:0090092	0.531	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010467	0.526	gene expression
GO:0051246	0.518	regulation of protein metabolic process
GO:0009967	0.499	positive regulation of signal transduction
GO:0042221	0.473	response to chemical
GO:0070848	0.472	response to growth factor
GO:0019220	0.469	regulation of phosphate metabolic process
GO:0048468	0.453	cell development
GO:0071363	0.451	cellular response to growth factor stimulus
GO:0007369	0.446	gastrulation
GO:0009892	0.417	negative regulation of metabolic process
GO:0010605	0.412	negative regulation of macromolecule metabolic process
GO:0045944	0.398	positive regulation of transcription by RNA polymerase II
GO:1901564	0.394	organonitrogen compound metabolic process
GO:0090100	0.356	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0042325	0.340	regulation of phosphorylation
GO:0001932	0.333	regulation of protein phosphorylation
GO:0042127	0.327	regulation of cell population proliferation
GO:0001704	0.316	formation of primary germ layer
GO:0051247	0.313	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0032991	0.988	protein-containing complex
GO:0005622	0.975	intracellular anatomical structure
GO:0005737	0.961	cytoplasm
GO:0043226	0.478	organelle
GO:0043227	0.472	membrane-bounded organelle
GO:0016020	0.464	membrane
GO:0071944	0.395	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]