StarFunc result for job id P08514

User Input

>input (1039 residues)
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDS
HGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKA
RQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGN
TLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRP
GILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEI
LDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQV
LVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR
AQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQ
LDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSL
NVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADN
VLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCEL
GNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVE
LRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQP
SDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQP
SRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAW
FNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWK
VGFFKRNRPPLEEDDEEGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3fcsA	0.874	0.994	0.000	913	0.875	0.996	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
2	AFDB:A0A023GU64	0.834	0.819	0.000	1059	0.393	0.385	A0A023GU64.pdb.gz
3	AFDB:A0A0G2JVZ6	0.829	0.820	0.000	1052	0.369	0.364	A0A0G2JVZ6.pdb.gz	A0A0G2JVZ6_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=2
4	AFDB:A0A0G2K1E2	0.837	0.794	0.000	1099	0.372	0.352	A0A0G2K1E2.pdb.gz	A0A0G2K1E2_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=3 SV=2
5	AFDB:A2ARA8	0.844	0.827	0.000	1062	0.398	0.390	A2ARA8.pdb.gz	ITA8_MOUSE Integrin alpha-8 OS=Mus musculus OX=10090 GN=Itga8 PE=1 SV=1
6	AFDB:B3DIZ6	0.818	0.819	0.000	1037	0.423	0.424	B3DIZ6.pdb.gz
7	AFDB:B3DJQ3	0.838	0.834	0.000	1045	0.363	0.361	B3DJQ3.pdb.gz
8	AFDB:D3ZAC0	0.934	0.938	0.000	1034	0.782	0.785	D3ZAC0.pdb.gz	D3ZAC0_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=3
9	AFDB:L7RXH0	0.832	0.826	0.000	1048	0.374	0.371	L7RXH0.pdb.gz	L7RXH0_HUMAN Integrin, alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=3 SV=1
10	AFDB:P08514	1.000	1.000	0.000	1039	1.000	1.000	P08514.pdb.gz	ITA2B_HUMAN Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=3
11	AFDB:P08648	0.836	0.829	0.000	1049	0.381	0.378	P08648.pdb.gz	ITA5_HUMAN Integrin alpha-5 OS=Homo sapiens OX=9606 GN=ITGA5 PE=1 SV=2
12	PDB:4g1eA	0.760	0.814	6.329E-98	964	0.350	0.378	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
13	PDB:7nxdA	0.525	0.597	1.114E-94	905	0.347	0.399	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
14	PDB:7uslA	0.553	0.653	5.689E-58	856	0.191	0.231	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
15	PDB:4nehA	0.594	0.572	7.777E-55	1084	0.205	0.196	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
16	PDB:4nenA	0.526	0.515	6.289E-53	1063	0.206	0.201	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
17	PDB:3k6sC	0.580	0.666	8.956E-53	885	0.206	0.242	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
18	PDB:5a42A	0.097	0.077	1.242E-8	1597	0.110	0.071	5a42A.pdb.gz
19	PDB:7sqcO0	0.099	0.091	8.461E-8	1140	0.112	0.102	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:4ziqA	0.104	0.083	1.402E-7	1450	0.088	0.063	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A3B3IU79	1629	811	0.778	0.996	A0A3B3IU79_HUMAN Integrin subunit alpha 2b (Fragment) OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=1
2	A0A8I5Y696	634	1009	0.383	0.394	A0A8I5Y696_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
3	A0A8I5YCC9	609	1050	0.371	0.367	A0A8I5YCC9_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=1 SV=1
4	A0A8I6A7G7	598	1044	0.369	0.367	A0A8I6A7G7_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=1 SV=1
5	A0A8I6GGN2	1603	1037	0.780	0.781	A0A8I6GGN2_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=1
6	A0A8I6GID8	652	1063	0.393	0.384	A0A8I6GID8_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
7	A2ARA8	681	1062	0.401	0.393	ITA8_MOUSE Integrin alpha-8 OS=Mus musculus OX=10090 GN=Itga8 PE=1 SV=1
8	A2RQD8	616	1046	0.372	0.370	A2RQD8_PIG Alpha v integrin subunit variant OS=Sus scrofa OX=9823 GN=ITGAV PE=2 SV=1
9	B5DEG1	686	1062	0.399	0.391	B5DEG1_RAT RGD1564327 protein OS=Rattus norvegicus OX=10116 GN=Itga8 PE=2 SV=1
10	D3ZAC0	1545	1020	0.760	0.775	D3ZAC0_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=3
11	D3ZXC1	907	639	0.440	0.715	D3ZXC1_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=3
12	F1LZX9	612	1042	0.372	0.370	F1LZX9_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=4
13	F7F1E3	671	1086	0.398	0.381	F7F1E3_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
14	G3HHR9	554	944	0.347	0.382	G3HHR9_CRIGR Integrin alpha-V OS=Cricetulus griseus OX=10029 GN=I79_010178 PE=3 SV=1
15	L7RXH0	611	1048	0.377	0.374	L7RXH0_HUMAN Integrin, alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=3 SV=1
16	P06756	611	1048	0.377	0.374	ITAV_HUMAN Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=2
17	P08514	2118	1039	1.000	1.000	ITA2B_HUMAN Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=3
18	P08648	616	1049	0.379	0.376	ITA5_HUMAN Integrin alpha-5 OS=Homo sapiens OX=9606 GN=ITGA5 PE=1 SV=2
19	P11688	605	1053	0.367	0.362	ITA5_MOUSE Integrin alpha-5 OS=Mus musculus OX=10090 GN=Itga5 PE=1 SV=3
20	P26008	609	1034	0.366	0.368	ITAV_CHICK Integrin alpha-V OS=Gallus gallus OX=9031 GN=ITGAV PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	1.5e-22	90.3	FG-GAP repeat
2	PF13517 FG-GAP_3	8.2e-09	47.2	FG-GAP-like repeat
3	PF00357 Integrin_alpha	0.082	23.9	Integrin alpha cytoplasmic region
4	PF08441 Integrin_alpha2	2.8e-117	404.3	Integrin alpha

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262407

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452786	0.999	Integrin beta-3
2	9606.ENSP00000261405	0.998	Von Willebrand factor
3	9606.ENSP00000346839	0.997	Fibronectin type III domain containing
4	9606.ENSP00000226218	0.981	Vitronectin
5	9606.ENSP00000365858	0.968	Erythroid transcription factor
6	9606.ENSP00000358866	0.963	Filamin-A
7	9606.ENSP00000479860	0.960	Calcium and integrin binding 1
8	9606.ENSP00000337825	0.953	Tyrosine-protein kinase Lck
9	9606.ENSP00000326630	0.943	Zinc finger protein ZFPM1
10	9606.ENSP00000379350	0.938	Integrin beta-1
11	9606.ENSP00000263686	0.937	P-selectin
12	9606.ENSP00000355361	0.936	Leukocyte surface antigen CD47
13	9606.ENSP00000451828	0.935	RAC-alpha serine/threonine-protein kinase
14	9606.ENSP00000260356	0.933	Thrombospondin-1
15	9606.ENSP00000306361	0.933	Fibrinogen alpha chain
16	9606.ENSP00000293328	0.931	Signal transducer and activator of transcription 5B
17	9606.ENSP00000300305	0.931	Runt-related transcription factor 1
18	9606.ENSP00000341208	0.930	Signal transducer and activator of transcription 5A
19	9606.ENSP00000415151	0.929	Core-binding factor subunit beta
20	9606.ENSP00000306099	0.924	Fibrinogen beta chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060090	0.991	molecular adaptor activity
GO:0042802	0.947	identical protein binding
GO:0044877	0.937	protein-containing complex binding
GO:0005102	0.606	signaling receptor binding
GO:0050839	0.561	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0009987	0.995	cellular process
GO:0050896	0.994	response to stimulus
GO:0050794	0.992	regulation of cellular process
GO:0007155	0.974	cell adhesion
GO:0048518	0.897	positive regulation of biological process
GO:0051716	0.884	cellular response to stimulus
GO:0040012	0.837	regulation of locomotion
GO:0048522	0.800	positive regulation of cellular process
GO:2000145	0.790	regulation of cell motility
GO:0007165	0.778	signal transduction
GO:0032501	0.754	multicellular organismal process
GO:0007166	0.746	cell surface receptor signaling pathway
GO:0007229	0.546	integrin-mediated signaling pathway
GO:0006950	0.499	response to stress
GO:0040017	0.438	positive regulation of locomotion
GO:0030334	0.437	regulation of cell migration
GO:0032502	0.408	developmental process
GO:0048856	0.403	anatomical structure development
GO:0030335	0.305	positive regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0009986	0.993	cell surface
GO:0043227	0.948	membrane-bounded organelle
GO:0005622	0.912	intracellular anatomical structure
GO:0005737	0.761	cytoplasm
GO:0043231	0.759	intracellular membrane-bounded organelle
GO:0005576	0.756	extracellular region
GO:0031982	0.747	vesicle
GO:0005615	0.462	extracellular space
GO:0012505	0.426	endomembrane system
GO:0032991	0.412	protein-containing complex
GO:0070062	0.372	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]