StarFunc result for job id P08519

User Input

>input (1400 residues)
MEHKEVVLLLLLFLKSAAPEQSHVVQDCYHGDGQSYRGTYSTTVTGRTCQAWSSMTPHQH
NRTTENYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTP
VPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEY
YPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEA
PSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL
IMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAP
TEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCR
NPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPG
VQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVA
APYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYH
GNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYT
RDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSY
RGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVR
WEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYST
TVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNL
TQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRT
CQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDA
EGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSS
MTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVA
PPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSH
SRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTP
VPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEY
YPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEA
PSEQAPTEQRPGVQECYHGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06868	0.099	0.148	4.964E-56	812	0.172	0.297	P06868.pdb.gz	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
2	AFDB:P20918	0.290	0.481	6.564E-56	812	0.166	0.287	P20918.pdb.gz	PLMN_MOUSE Plasminogen OS=Mus musculus OX=10090 GN=Plg PE=1 SV=3
3	PDB:4a5tS	0.090	0.141	1.306E-51	767	0.169	0.309	4a5tS.pdb.gz
4	PDB:4duuA	0.130	0.249	8.428E-37	682	0.136	0.280	4duuA.pdb.gz
5	PDB:5edmA	0.059	0.147	1.911E-13	550	0.046	0.118	5edmA.pdb.gz	How the Linker Connecting the Two Kringles Influences Activation and Conformational Plasticity of Prothrombin.
6	PDB:6bjrA	0.058	0.136	5.603E-9	575	0.046	0.113	6bjrA.pdb.gz	Structure of prothrombin in the closed form reveals new details on the mechanism of activation.
7	AFDB:Q383H0	0.057	0.055	2.217E-1	1439	0.118	0.115	Q383H0.pdb.gz	Q383H0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2880 PE=4 SV=1
8	AFDB:P08120	0.041	0.036	4.101E-1	1779	0.120	0.094	P08120.pdb.gz	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
9	AFDB:Q59IW6	0.028	0.032	5.423E-1	1179	0.102	0.121	Q59IW6.pdb.gz	Q59IW6_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
10	AFDB:Q6WRH9	0.034	0.025	7.585E-1	2597	0.137	0.074	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
11	AFDB:Q9VMV5	0.037	0.029	1.003	1940	0.139	0.100	Q9VMV5.pdb.gz	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
12	AFDB:Q9VR13	0.027	0.031	1.186	1136	0.159	0.196	Q9VR13.pdb.gz	Q9VR13_DROME Basic proline-rich protein-like OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15635 PE=4 SV=4
13	AFDB:B0G126	0.032	0.022	1.327	2656	0.096	0.051	B0G126.pdb.gz	FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum OX=44689 GN=pip5k3 PE=3 SV=1
14	AFDB:Q8I1Y8	0.041	0.030	1.569	2271	0.072	0.044	Q8I1Y8.pdb.gz	Q8I1Y8_PLAF7 AP2 domain transcription factor AP2-SP2, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0404100 PE=4 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08519	0.0	1055	2040	0.380	0.261	APOA_HUMAN Apolipoprotein(a) OS=Homo sapiens OX=9606 GN=LPA PE=1 SV=2
2	P00747	2.30e-141	454	810	0.180	0.311	PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
3	P06868	1.73e-139	449	812	0.176	0.303	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
4	P20918	7.09e-138	445	812	0.171	0.294	PLMN_MOUSE Plasminogen OS=Mus musculus OX=10090 GN=Plg PE=1 SV=3
5	Q01177	2.11e-134	436	812	0.171	0.296	PLMN_RAT Plasminogen OS=Rattus norvegicus OX=10116 GN=Plg PE=2 SV=2
6	P70521	3.25e-77	273	716	0.116	0.228	P70521_RAT Macrophage stimulating 1 (Hepatocyte growth factor-like) OS=Rattus norvegicus OX=10116 GN=Mst1 PE=2 SV=1
7	F7FMS0	1.47e-76	272	739	0.119	0.225	F7FMS0_RAT Macrophage stimulating 1 OS=Rattus norvegicus OX=10116 GN=Mst1 PE=4 SV=1
8	P14210	1.56e-76	271	728	0.115	0.221	HGF_HUMAN Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2
9	P26928	2.29e-75	268	716	0.114	0.222	HGFL_MOUSE Hepatocyte growth factor-like protein OS=Mus musculus OX=10090 GN=Mst1 PE=2 SV=2
10	P17945	2.68e-75	268	728	0.114	0.218	HGF_RAT Hepatocyte growth factor OS=Rattus norvegicus OX=10116 GN=Hgf PE=1 SV=1
11	Q08048	8.83e-75	266	728	0.113	0.217	HGF_MOUSE Hepatocyte growth factor OS=Mus musculus OX=10090 GN=Hgf PE=1 SV=1
12	Q90ZN6	1.53e-74	265	709	0.111	0.220	Q90ZN6_DANRE Hepatocyte growth factor-like 1 OS=Danio rerio OX=7955 GN=hgfl1 PE=2 SV=1
13	P26927	4.42e-74	264	711	0.114	0.225	HGFL_HUMAN Hepatocyte growth factor-like protein OS=Homo sapiens OX=9606 GN=MST1 PE=1 SV=2
14	Q90978	1.02e-72	260	726	0.111	0.213	Q90978_CHICK Hepatocyte growth factor OS=Gallus gallus OX=9031 GN=HGF PE=2 SV=3
15	Q5RGG3	2.24e-69	250	699	0.107	0.215	Q5RGG3_DANRE Hepatocyte growth factor OS=Danio rerio OX=7955 GN=hgf1 PE=3 SV=1
16	F1REK1	2.40e-69	250	712	0.107	0.211	F1REK1_DANRE Hepatocyte growth factor OS=Danio rerio OX=7955 GN=hgf1 PE=3 SV=1
17	Q788Q2	9.18e-62	219	405	0.094	0.326	Q788Q2_CHICK HGF protein ( SFprotein ) (Fragment) OS=Gallus gallus OX=9031 GN=HGF PE=2 SV=1
18	Q16609	7.80e-53	183	132	0.070	0.742	LPAL2_HUMAN Putative apolipoprotein(a)-like protein 2 OS=Homo sapiens OX=9606 GN=LPAL2 PE=5 SV=1
19	P00735	2.61e-26	118	625	0.054	0.120	THRB_BOVIN Prothrombin OS=Bos taurus OX=9913 GN=F2 PE=1 SV=2
20	E7FAN5	3.86e-26	118	635	0.051	0.112	E7FAN5_DANRE Prothrombin OS=Danio rerio OX=7955 GN=wu:fb57c10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20056 DUF6455	0.34	22.3	Family of unknown function (DUF6455)
2	PF18758 KDZ	8.8e-07	40.3	Kyakuja-Dileera-Zisupton transposase
3	PF00051 Kringle	0	1094.2	Kringle domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321334

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233242	0.999	Apolipoprotein B-100
2	9606.ENSP00000236850	0.995	Apolipoprotein A-I
3	9606.ENSP00000356969	0.983	Apolipoprotein A-II
4	9606.ENSP00000350425	0.968	Apolipoprotein A-IV
5	9606.ENSP00000365081	0.957	Apolipoprotein M
6	9606.ENSP00000227667	0.956	Apolipoprotein C-III
7	9606.ENSP00000252486	0.950	Apolipoprotein E
8	9606.ENSP00000205948	0.945	Beta-2-glycoprotein 1
9	9606.ENSP00000200676	0.943	Cholesteryl ester transfer protein
10	9606.ENSP00000466775	0.934	Apolipoprotein C-II
11	9606.ENSP00000417138	0.928	Phospholipid transfer protein
12	9606.ENSP00000264005	0.917	Phosphatidylcholine-sterol acyltransferase
13	9606.ENSP00000445002	0.917	Apolipoprotein A-V
14	9606.ENSP00000441691	0.914	Integrin alpha-M
15	9606.ENSP00000222381	0.912	Serum paraoxonase/arylesterase 1
16	9606.ENSP00000465356	0.908	Apolipoprotein C-I
17	9606.ENSP00000380948	0.902	Integrin beta-2
18	9606.ENSP00000468236	0.870	Apolipoprotein C-IV
19	9606.ENSP00000315130	0.868	Clusterin
20	9606.ENSP00000317674	0.857	Apolipoprotein L1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0061135	0.997	endopeptidase regulator activity
GO:0030414	0.997	peptidase inhibitor activity
GO:0008233	0.995	peptidase activity
GO:0034185	0.994	apolipoprotein binding
GO:0004252	0.990	serine-type endopeptidase activity
GO:0001968	0.989	fibronectin binding
GO:0019899	0.910	enzyme binding
GO:0004866	0.838	endopeptidase inhibitor activity
GO:0019900	0.704	kinase binding
GO:0005102	0.675	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.928	multicellular organismal process
GO:0008015	0.853	blood circulation
GO:0009987	0.654	cellular process
GO:0065007	0.569	biological regulation
GO:0050789	0.548	regulation of biological process
GO:0050794	0.370	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0032994	0.991	protein-lipid complex
GO:0034358	0.977	plasma lipoprotein particle
GO:0031982	0.622	vesicle
GO:0043229	0.496	intracellular organelle
GO:0043231	0.468	intracellular membrane-bounded organelle
GO:0012505	0.381	endomembrane system
GO:0030312	0.363	external encapsulating structure
GO:0009986	0.359	cell surface
GO:0005737	0.350	cytoplasm
GO:0062023	0.335	collagen-containing extracellular matrix
GO:0030054	0.308	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.995	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.990	Serine endopeptidases.

[back to server]