StarFunc result for job id P08559

User Input

>input (390 residues)
MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTRED
GLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRA
HGFTFTRGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALA
CKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAAST
DYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPP
LEELGYHIYSSDPPFEVRGANQWIKFKSVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29803	0.940	0.945	4.606E-69	388	0.826	0.830	P29803.pdb.gz	ODPAT_HUMAN Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA2 PE=1 SV=1
2	PDB:3exeA	0.928	0.997	7.731E-68	363	0.926	0.994	3exeA.pdb.gz	Structural basis for inactivation of the human pyruvate dehydrogenase complex by phosphorylation: role of disordered phosphorylation loops.
3	AFDB:P35487	0.946	0.944	8.745E-68	391	0.774	0.772	P35487.pdb.gz	ODPAT_MOUSE Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha2 PE=1 SV=1
4	PDB:6cerA	0.867	0.988	1.452E-61	342	0.869	0.991	6cerA.pdb.gz	Pyruvate dehydrogenase complex deficiency is linked to regulatory loop disorder in the alpha V138M variant of human pyruvate dehydrogenase.
5	AFDB:Q8I111	0.916	0.863	7.193E-53	414	0.569	0.536	Q8I111.pdb.gz	Q8I111_CAEEL Pyruvate dehydrogenase E1 component subunit alpha OS=Caenorhabditis elegans OX=6239 GN=pdha-1 PE=1 SV=1
6	AFDB:Q7KVX1	0.907	0.800	9.594E-50	443	0.554	0.488	Q7KVX1.pdb.gz	Q7KVX1_DROME Pyruvate dehydrogenase E1 component subunit alpha OS=Drosophila melanogaster OX=7227 GN=Pdha PE=1 SV=1
7	AFDB:Q54C70	0.875	0.904	1.949E-49	377	0.485	0.501	Q54C70.pdb.gz	ODPA_DICDI Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=pdhA PE=1 SV=1
8	AFDB:P16387	0.886	0.825	2.145E-48	420	0.477	0.443	P16387.pdb.gz	ODPA_YEAST Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDA1 PE=1 SV=2
9	AFDB:Q8H1Y0	0.898	0.891	2.145E-48	393	0.472	0.468	Q8H1Y0.pdb.gz	ODPA2_ARATH Pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IAR4 PE=1 SV=2
10	AFDB:P52901	0.881	0.883	4.126E-48	389	0.477	0.478	P52901.pdb.gz	ODPA1_ARATH Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=E1 ALPHA PE=1 SV=2
11	AFDB:Q9ZQY0	0.894	0.889	8.273E-47	392	0.477	0.474	Q9ZQY0.pdb.gz	Q9ZQY0_MAIZE Pyruvate dehydrogenase E1 component subunit alpha OS=Zea mays OX=4577 PE=4 SV=1
12	AFDB:Q5B2R8	0.863	0.832	1.029E-46	405	0.464	0.447	Q5B2R8.pdb.gz	Q5B2R8_EMENI Pyruvate dehydrogenase E1 component subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05162 PE=4 SV=1
13	PDB:1umbA	0.775	0.833	5.200E-25	362	0.244	0.262	1umbA.pdb.gz	Ligand-induced Conformational Changes and a Reaction Intermediate in Branched-chain 2-Oxo Acid Dehydrogenase (E1) from Thermus thermophilus HB8, as Revealed by X-ray Crystallography
14	PDB:2bffA	0.781	0.777	2.669E-24	392	0.246	0.245	2bffA.pdb.gz	A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
15	PDB:3dufA	0.741	0.789	6.301E-23	365	0.249	0.266	3dufA.pdb.gz	Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multienzyme complex
16	PDB:1um9C	0.695	0.805	3.559E-21	335	0.226	0.263	1um9C.pdb.gz
17	PDB:3dv0E	0.693	0.781	1.391E-20	344	0.223	0.253	3dv0E.pdb.gz	Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multienzyme complex
18	PDB:1v1mA	0.715	0.748	2.825E-20	372	0.205	0.215	1v1mA.pdb.gz	Cross-Talk between Thiamin Diphosphate Binding and Phosphorylation Loop Conformation in Human Branched-Chain Alpha-Keto Acid Decarboxylase/Dehydrogenase.
19	PDB:6u3jA	0.596	0.288	4.636E-12	876	0.169	0.075	6u3jA.pdb.gz	Inhibition and Crystal Structure of the Human DHTKD1-Thiamin Diphosphate Complex.
20	PDB:6vefA	0.598	0.295	1.401E-8	844	0.162	0.075	6vefA.pdb.gz	Cryo-EM Structure of Escherichia coli 2-oxoglutarate dehydrogenase E1 component sucA

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08559	0.0	814	390	1.000	1.000	ODPA_HUMAN Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1 PE=1 SV=3
2	P26284	0.0	801	390	0.979	0.979	ODPA_RAT Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdha1 PE=1 SV=2
3	P29803	0.0	698	388	0.854	0.858	ODPAT_HUMAN Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA2 PE=1 SV=1
4	P35486	0.0	803	390	0.982	0.982	ODPA_MOUSE Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1
5	P35487	0.0	628	391	0.774	0.772	ODPAT_MOUSE Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha2 PE=1 SV=1
6	Q06437	0.0	637	391	0.787	0.785	ODPAT_RAT Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdha2 PE=1 SV=1
7	Q5JPU2	0.0	799	418	1.000	0.933	Q5JPU2_HUMAN Pyruvate dehydrogenase E1 component subunit alpha OS=Homo sapiens OX=9606 GN=PDHA1 PE=1 SV=2
8	Q8I111	1.25e-167	477	414	0.569	0.536	Q8I111_CAEEL Pyruvate dehydrogenase E1 component subunit alpha OS=Caenorhabditis elegans OX=6239 GN=pdha-1 PE=1 SV=1
9	P52899	1.44e-167	476	397	0.569	0.559	ODPA_CAEEL Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=T05H10.6 PE=3 SV=1
10	Q9W4H6	2.26e-159	455	399	0.567	0.554	Q9W4H6_DROME Pyruvate dehydrogenase E1 component subunit alpha OS=Drosophila melanogaster OX=7227 GN=Pdha PE=1 SV=2
11	Q7KVX1	6.72e-158	453	443	0.554	0.488	Q7KVX1_DROME Pyruvate dehydrogenase E1 component subunit alpha OS=Drosophila melanogaster OX=7227 GN=Pdha PE=1 SV=1
12	Q7YU05	4.24e-145	416	328	0.500	0.595	Q7YU05_DROME Pyruvate dehydrogenase E1 component subunit alpha OS=Drosophila melanogaster OX=7227 GN=Pdha PE=1 SV=1
13	Q5JPT9	9.66e-141	400	203	0.503	0.966	Q5JPT9_HUMAN Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=PDHA1 PE=1 SV=8
14	Q54C70	2.06e-139	404	377	0.500	0.517	ODPA_DICDI Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=pdhA PE=1 SV=1
15	P16387	1.13e-130	383	420	0.449	0.417	ODPA_YEAST Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDA1 PE=1 SV=2
16	Q10489	9.22e-128	375	409	0.474	0.452	ODPA_SCHPO Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pda1 PE=1 SV=1
17	P52901	9.85e-128	374	389	0.462	0.463	ODPA1_ARATH Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=E1 ALPHA PE=1 SV=2
18	Q8H1Y0	3.20e-125	368	393	0.487	0.483	ODPA2_ARATH Pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IAR4 PE=1 SV=2
19	Q5B2R8	3.59e-125	369	405	0.462	0.444	Q5B2R8_EMENI Pyruvate dehydrogenase E1 component subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05162 PE=4 SV=1
20	Q9ZQY0	1.21e-123	364	392	0.469	0.467	Q9ZQY0_MAIZE Pyruvate dehydrogenase E1 component subunit alpha OS=Zea mays OX=4577 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13292 DXP_synthase_N	1.3	19.8	1-deoxy-D-xylulose-5-phosphate synthase
2	PF00676 E1_dh	8.2e-121	414.2	Dehydrogenase E1 component
3	PF02775 TPP_enzyme_C	11	17.2	Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011992

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008892	0.999	Acetyltransferase component of pyruvate dehydrogenase complex
2	61853.ENSNLEP00000008921	0.999	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2.
3	61853.ENSNLEP00000010539	0.999	Dihydrolipoamide dehydrogenase
4	61853.ENSNLEP00000021782	0.998	Pyruvate dehydrogenase complex, component X
5	61853.ENSNLEP00000002569	0.996	Uncharacterized protein
6	61853.ENSNLEP00000006839	0.996	Pyruvate dehydrogenase kinase, isozyme 1
7	61853.ENSNLEP00000016838	0.991	Pyruvate kinase, muscle
8	61853.ENSNLEP00000015126	0.969	Branched chain keto acid dehydrogenase E1, beta polypeptide
9	61853.ENSNLEP00000010874	0.955	Pyruvate dehydrogenase kinase, isozyme 2
10	61853.ENSNLEP00000021260	0.948	Citrate synthase
11	61853.ENSNLEP00000012266	0.939	Pyruvate dehydrogenase kinase, isozyme 3
12	61853.ENSNLEP00000022506	0.929	Pyruvate dehydrogenase E1 component subunit alpha
13	61853.ENSNLEP00000014401	0.926	Malic enzyme 2, NAD(+)-dependent, mitochondrial
14	61853.ENSNLEP00000015407	0.926	Malic enzyme 1, NADP(+)-dependent, cytosolic
15	61853.ENSNLEP00000019627	0.926	Malic enzyme 3, NADP(+)-dependent, mitochondrial
16	61853.ENSNLEP00000014682	0.919	Pyruvate kinase, liver and RBC
17	61853.ENSNLEP00000014291	0.885	Belongs to the GPI family
18	61853.ENSNLEP00000019834	0.865	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
19	61853.ENSNLEP00000019256	0.858	Pyruvate dehydrogenase kinase, isozyme 4
20	61853.ENSNLEP00000003597	0.850	Pyruvate dehyrogenase phosphatase catalytic subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016624	1.000	oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
GO:0004738	1.000	pyruvate dehydrogenase activity
GO:0005515	0.996	protein binding
GO:0004739	0.848	pyruvate dehydrogenase (acetyl-transferring) activity
GO:0043167	0.325	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006084	0.998	acetyl-CoA metabolic process
GO:0071616	0.998	acyl-CoA biosynthetic process
GO:0006085	0.993	acetyl-CoA biosynthetic process
GO:0006090	0.989	pyruvate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0031981	0.979	nuclear lumen
GO:0032991	0.963	protein-containing complex
GO:0005759	0.942	mitochondrial matrix
GO:0043232	0.925	intracellular non-membrane-bounded organelle
GO:1902494	0.908	catalytic complex
GO:1990204	0.879	oxidoreductase complex
GO:0098798	0.780	mitochondrial protein-containing complex
GO:0005730	0.737	nucleolus
GO:0045254	0.365	pyruvate dehydrogenase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.4.-	1.000	With a disulfide as acceptor.
RHEA:19189	0.848	(R)-N(6)-lipoyl-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + H(+) + pyruvate = (R)-N(6)-(S(8)-acetyldihydrolipoyl)-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + CO2
EC:1.2.4.1	0.848	pyruvate dehydrogenase (acetyl-transferring).

[back to server]