StarFunc result for job id P08567

User Input

>input (350 residues)
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQ
DFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRL
PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMI
ASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEE
FRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSV
ESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08567	1.000	1.000	2.847E-69	350	1.000	1.000	P08567.pdb.gz	PLEK_HUMAN Pleckstrin OS=Homo sapiens OX=9606 GN=PLEK PE=1 SV=3
2	AFDB:Q9WV52	0.345	0.342	3.263E-33	353	0.374	0.371	Q9WV52.pdb.gz	PLEK2_MOUSE Pleckstrin-2 OS=Mus musculus OX=10090 GN=Plek2 PE=1 SV=1
3	AFDB:Q9HB19	0.379	0.329	3.718E-13	425	0.191	0.158	Q9HB19.pdb.gz	PKHA2_HUMAN Pleckstrin homology domain-containing family A member 2 OS=Homo sapiens OX=9606 GN=PLEKHA2 PE=1 SV=2
4	AFDB:Q8BM47	0.258	0.123	5.461E-13	761	0.149	0.068	Q8BM47.pdb.gz	PKHM3_MOUSE Pleckstrin homology domain-containing family M member 3 OS=Mus musculus OX=10090 GN=Plekhm3 PE=1 SV=1
5	AFDB:Q5RGS4	0.291	0.268	5.770E-13	383	0.194	0.178	Q5RGS4.pdb.gz	Q5RGS4_HUMAN Pleckstrin homology domain containing A1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=1
6	AFDB:Q9ERS5	0.259	0.215	1.550E-12	425	0.186	0.153	Q9ERS5.pdb.gz	PKHA2_MOUSE Pleckstrin homology domain-containing family A member 2 OS=Mus musculus OX=10090 GN=Plekha2 PE=1 SV=1
7	AFDB:O94887	0.276	0.105	1.931E-12	1054	0.163	0.054	O94887.pdb.gz	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
8	AFDB:Q9HB21	0.292	0.256	2.040E-12	404	0.197	0.171	Q9HB21.pdb.gz	PKHA1_HUMAN Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=2
9	AFDB:Q8VH46	0.265	0.131	2.996E-12	731	0.186	0.089	Q8VH46.pdb.gz	AFAP1_RAT Actin filament-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Afap1 PE=1 SV=1
10	AFDB:E9QIC8	0.280	0.106	4.649E-12	1025	0.143	0.049	E9QIC8.pdb.gz	E9QIC8_DANRE FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) OS=Danio rerio OX=7955 GN=farp1 PE=1 SV=1
11	PDB:7rx9A	0.256	0.209	1.741E-8	432	0.103	0.083	7rx9A.pdb.gz
12	PDB:3ljuX	0.239	0.226	4.678E-8	373	0.123	0.115	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:6bbpA	0.242	0.165	1.488E-6	520	0.097	0.065	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
14	PDB:6u3eA	0.227	0.200	4.713E-6	397	0.100	0.088	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:6hhgA	0.246	0.224	1.135E-5	386	0.083	0.075	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
16	PDB:6s9wA	0.256	0.219	1.578E-5	411	0.080	0.068	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
17	PDB:4mk0A	0.251	0.143	1.419E-4	631	0.046	0.025	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:4mt6A	0.258	0.235	1.673E-4	389	0.063	0.057	4mt6A.pdb.gz
19	PDB:7c3mA	0.243	0.158	1.673E-4	577	0.123	0.075	7c3mA.pdb.gz
20	PDB:4uudC	0.245	0.672	2.326E-4	113	0.066	0.204	4uudC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08567	0.0	731	350	1.000	1.000	PLEK_HUMAN Pleckstrin OS=Homo sapiens OX=9606 GN=PLEK PE=1 SV=3
2	Q9JHK5	0.0	680	350	0.917	0.917	PLEK_MOUSE Pleckstrin OS=Mus musculus OX=10090 GN=Plek PE=1 SV=1
3	Q9WV52	2.45e-80	251	353	0.374	0.371	PLEK2_MOUSE Pleckstrin-2 OS=Mus musculus OX=10090 GN=Plek2 PE=1 SV=1
4	Q55GV3	4.42e-09	60.1	477	0.109	0.080	PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum OX=44689 GN=pakC PE=1 SV=2
5	Q1LYE0	4.26e-08	57.0	588	0.103	0.061	Q1LYE0_DANRE Switch-associated protein 70 OS=Danio rerio OX=7955 GN=fc45f07 PE=1 SV=1
6	Q54KA7	5.01e-08	57.0	986	0.091	0.032	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
7	Q9UH65	6.51e-08	56.6	585	0.103	0.062	SWP70_HUMAN Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1
8	E7EMB1	7.64e-08	56.2	527	0.103	0.068	E7EMB1_HUMAN Switching B cell complex subunit SWAP70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1
9	Q7SYB5	1.17e-07	55.8	612	0.109	0.062	DEFI6_DANRE Differentially expressed in FDCP 6 homolog OS=Danio rerio OX=7955 GN=def6 PE=2 SV=1
10	Q5RGS4	1.19e-07	55.5	383	0.109	0.099	Q5RGS4_HUMAN Pleckstrin homology domain containing A1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=1
11	Q6A028	1.25e-07	55.5	585	0.103	0.062	SWP70_MOUSE Switch-associated protein 70 OS=Mus musculus OX=10090 GN=Swap70 PE=1 SV=2
12	Q9H4E7	2.04e-07	55.1	631	0.100	0.055	DEFI6_HUMAN Differentially expressed in FDCP 6 homolog OS=Homo sapiens OX=9606 GN=DEF6 PE=1 SV=1
13	Q8BUL6	2.42e-07	54.3	383	0.106	0.097	PKHA1_MOUSE Pleckstrin homology domain-containing family A member 1 OS=Mus musculus OX=10090 GN=Plekha1 PE=1 SV=1
14	Q9HB21	3.41e-07	53.9	404	0.100	0.087	PKHA1_HUMAN Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=2
15	Q8N264	7.12e-07	53.5	748	0.089	0.041	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
16	Q9HB19	8.35e-07	52.8	425	0.100	0.082	PKHA2_HUMAN Pleckstrin homology domain-containing family A member 2 OS=Homo sapiens OX=9606 GN=PLEKHA2 PE=1 SV=2
17	Q8C4V1	1.65e-06	52.4	747	0.089	0.041	RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus OX=10090 GN=Arhgap24 PE=1 SV=2
18	Q9ERS5	1.67e-06	52.0	425	0.100	0.082	PKHA2_MOUSE Pleckstrin homology domain-containing family A member 2 OS=Mus musculus OX=10090 GN=Plekha2 PE=1 SV=1
19	Q8C2K1	2.35e-06	51.6	630	0.097	0.054	DEFI6_MOUSE Differentially expressed in FDCP 6 OS=Mus musculus OX=10090 GN=Def6 PE=1 SV=1
20	Q6PW01	2.58e-06	51.2	398	0.094	0.083	Q6PW01_DANRE Cytohesin 1-like protein OS=Danio rerio OX=7955 GN=cyth1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	3.9e-13	60.6	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF00169 PH	1.6e-40	149.2	PH domain
3	PF15413 PH_11	0.0078	28.0	Pleckstrin homology domain
4	PF16652 PH_13	0.0031	28.9	Pleckstrin homology domain
5	PF20399 PH_20	0.006	28.0	PH domain
6	PF15406 PH_6	2.7e-07	42.3	Pleckstrin homology domain
7	PF15409 PH_8	2.8	19.6	Pleckstrin homology domain
8	PF15410 PH_9	1.4e-09	49.5	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234313

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354558	0.957	Serine/threonine-protein kinase mTOR
2	9606.ENSP00000358866	0.957	Filamin-A
3	9606.ENSP00000316029	0.938	Talin-1
4	9606.ENSP00000211998	0.936	Vinculin
5	9606.ENSP00000296511	0.923	Annexin A5
6	9606.ENSP00000467141	0.909	Titin
7	9606.ENSP00000357076	0.906	Transgelin-2
8	9606.ENSP00000270142	0.905	Superoxide dismutase [Cu-Zn]
9	9606.ENSP00000427687	0.905	WD repeat-containing protein 1
10	9606.ENSP00000413606	0.903	Syntaxin-binding protein 2
11	9606.ENSP00000248437	0.901	Tubulin alpha-4A chain
12	9606.ENSP00000278505	0.900	Endonuclease domain-containing 1 protein
13	9606.ENSP00000350267	0.900	Bromodomain and PHD finger-containing protein 3
14	9606.ENSP00000364398	0.900	Intracellular hyaluronan-binding protein 4
15	9606.ENSP00000432799	0.900	Mesencephalic astrocyte-derived neurotrophic factor
16	9606.ENSP00000451828	0.891	RAC-alpha serine/threonine-protein kinase
17	9606.ENSP00000383118	0.885	Cell division control protein 42 homolog
18	9606.ENSP00000430276	0.883	Proto-oncogene DBL
19	9606.ENSP00000483570	0.877	Tyrosine-protein kinase BTK
20	9606.ENSP00000046794	0.868	Lymphocyte cytosolic protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	1.000	protein dimerization activity
GO:0042802	1.000	identical protein binding
GO:0043325	1.000	phosphatidylinositol-3,4-bisphosphate binding
GO:0005080	1.000	protein kinase C binding
GO:0042803	0.994	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0110053	0.986	regulation of actin filament organization
GO:0051716	0.979	cellular response to stimulus
GO:0048518	0.976	positive regulation of biological process
GO:0030168	0.976	platelet activation
GO:0048522	0.965	positive regulation of cellular process
GO:0023052	0.961	signaling
GO:0016043	0.961	cellular component organization
GO:0070527	0.950	platelet aggregation
GO:0007154	0.948	cell communication
GO:0043243	0.941	positive regulation of protein-containing complex disassembly
GO:0007165	0.935	signal transduction
GO:1901879	0.927	regulation of protein depolymerization
GO:0008064	0.925	regulation of actin polymerization or depolymerization
GO:0030834	0.917	regulation of actin filament depolymerization
GO:0051179	0.874	localization
GO:0044087	0.867	regulation of cellular component biogenesis
GO:0051641	0.851	cellular localization
GO:0016192	0.823	vesicle-mediated transport
GO:1902905	0.809	positive regulation of supramolecular fiber organization
GO:0048519	0.771	negative regulation of biological process
GO:0019222	0.754	regulation of metabolic process
GO:0048583	0.723	regulation of response to stimulus
GO:0044089	0.705	positive regulation of cellular component biogenesis
GO:0008152	0.689	metabolic process
GO:0031323	0.683	regulation of cellular metabolic process
GO:0065009	0.682	regulation of molecular function
GO:0009893	0.670	positive regulation of metabolic process
GO:0071704	0.669	organic substance metabolic process
GO:0051495	0.664	positive regulation of cytoskeleton organization
GO:0044237	0.658	cellular metabolic process
GO:0009966	0.657	regulation of signal transduction
GO:0044238	0.632	primary metabolic process
GO:0045055	0.629	regulated exocytosis
GO:0050790	0.597	regulation of catalytic activity
GO:0051174	0.596	regulation of phosphorus metabolic process
GO:0080090	0.532	regulation of primary metabolic process
GO:0051336	0.529	regulation of hydrolase activity
GO:0019220	0.526	regulation of phosphate metabolic process
GO:0048523	0.516	negative regulation of cellular process
GO:0006996	0.451	organelle organization
GO:0044093	0.420	positive regulation of molecular function
GO:0051239	0.414	regulation of multicellular organismal process
GO:0031325	0.414	positive regulation of cellular metabolic process
GO:0007166	0.410	cell surface receptor signaling pathway
GO:0060255	0.345	regulation of macromolecule metabolic process
GO:0035303	0.333	regulation of dephosphorylation
GO:0009889	0.326	regulation of biosynthetic process
GO:0007186	0.326	G protein-coupled receptor signaling pathway
GO:0043085	0.325	positive regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	0.999	cytosol
GO:0005576	0.956	extracellular region
GO:0043226	0.858	organelle
GO:0043227	0.828	membrane-bounded organelle
GO:0042995	0.827	cell projection
GO:0043229	0.796	intracellular organelle
GO:0120025	0.792	plasma membrane bounded cell projection
GO:0098590	0.786	plasma membrane region
GO:0043231	0.741	intracellular membrane-bounded organelle
GO:0031252	0.707	cell leading edge
GO:0031253	0.705	cell projection membrane
GO:0031256	0.568	leading edge membrane
GO:0001726	0.565	ruffle
GO:0032587	0.424	ruffle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]