StarFunc result for job id P08571

User Input

>input (375 residues)
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08571	1.000	1.000	5.966E-65	375	1.000	1.000	P08571.pdb.gz	CD14_HUMAN Monocyte differentiation antigen CD14 OS=Homo sapiens OX=9606 GN=CD14 PE=1 SV=2
2	AFDB:Q63691	0.823	0.830	2.335E-39	372	0.613	0.618	Q63691.pdb.gz	CD14_RAT Monocyte differentiation antigen CD14 OS=Rattus norvegicus OX=10116 GN=Cd14 PE=2 SV=2
3	AFDB:P10810	0.824	0.844	3.440E-39	366	0.643	0.658	P10810.pdb.gz	CD14_MOUSE Monocyte differentiation antigen CD14 OS=Mus musculus OX=10090 GN=Cd14 PE=1 SV=1
4	AFDB:B0BL87	0.682	0.560	4.873E-16	465	0.277	0.224	B0BL87.pdb.gz	B0BL87_CHICK Monocyte differentiation antigen CD14 OS=Gallus gallus OX=9031 GN=Cd14 PE=2 SV=1
5	AFDB:E9PTD9	0.606	0.309	2.844E-8	784	0.155	0.074	E9PTD9.pdb.gz	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
6	AFDB:Q9QUN7	0.618	0.311	5.606E-8	784	0.168	0.080	Q9QUN7.pdb.gz	TLR2_MOUSE Toll-like receptor 2 OS=Mus musculus OX=10090 GN=Tlr2 PE=1 SV=1
7	AFDB:O60603	0.580	0.294	6.176E-8	784	0.163	0.078	O60603.pdb.gz	TLR2_HUMAN Toll-like receptor 2 OS=Homo sapiens OX=9606 GN=TLR2 PE=1 SV=1
8	AFDB:A5H0S2	0.545	0.334	1.794E-7	652	0.136	0.078	A5H0S2.pdb.gz	A5H0S2_CHICK Toll-like receptor 1-like protein b OS=Gallus gallus OX=9031 GN=TLR1Lb PE=2 SV=1
9	AFDB:Q9DD78	0.574	0.290	3.057E-7	793	0.171	0.081	Q9DD78.pdb.gz	TLR21_CHICK Toll-like receptor 2 type-1 OS=Gallus gallus OX=9031 GN=TLR2-1 PE=2 SV=1
10	AFDB:Q9BXR5	0.524	0.269	4.088E-7	811	0.133	0.062	Q9BXR5.pdb.gz	TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens OX=9606 GN=TLR10 PE=1 SV=2
11	PDB:1a4yA	0.353	0.300	1.592E-4	460	0.136	0.111	1a4yA.pdb.gz
12	PDB:7wv3A	0.463	0.281	8.682E-4	668	0.139	0.078	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:3t6qA	0.410	0.284	1.711E-3	601	0.149	0.093	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:7pzcA	0.398	0.168	1.885E-3	1010	0.128	0.048	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
15	PDB:7lhwA	0.334	0.090	2.647E-3	1813	0.147	0.030	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.
16	PDB:3b2dA	0.375	0.256	3.372E-3	601	0.149	0.093	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
17	PDB:7pmkL	0.266	0.222	3.540E-3	475	0.144	0.114	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:5yq5B	0.423	0.494	6.032E-3	306	0.125	0.154	5yq5B.pdb.gz
19	PDB:6zxdk	0.286	0.258	6.332E-3	430	0.128	0.112	6zxdk.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
20	PDB:6gffI	0.280	0.204	8.889E-3	551	0.171	0.116	6gffI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08571	0.0	752	375	1.000	1.000	CD14_HUMAN Monocyte differentiation antigen CD14 OS=Homo sapiens OX=9606 GN=CD14 PE=1 SV=2
2	P10810	5.54e-158	450	366	0.629	0.645	CD14_MOUSE Monocyte differentiation antigen CD14 OS=Mus musculus OX=10090 GN=Cd14 PE=1 SV=1
3	Q63691	4.85e-152	435	372	0.619	0.624	CD14_RAT Monocyte differentiation antigen CD14 OS=Rattus norvegicus OX=10116 GN=Cd14 PE=2 SV=2
4	B0BL87	6.00e-31	124	465	0.259	0.209	B0BL87_CHICK Monocyte differentiation antigen CD14 OS=Gallus gallus OX=9031 GN=Cd14 PE=2 SV=1
5	Q9DD78	2.98e-06	51.6	793	0.133	0.063	TLR21_CHICK Toll-like receptor 2 type-1 OS=Gallus gallus OX=9031 GN=TLR2-1 PE=2 SV=1
6	Q6YGU2	4.64e-06	50.8	784	0.112	0.054	Q6YGU2_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=2 SV=1
7	E9PTD9	4.89e-06	50.8	784	0.112	0.054	E9PTD9_RAT Toll-like receptor 2 OS=Rattus norvegicus OX=10116 GN=Tlr2 PE=1 SV=1
8	Q9QUN7	4.89e-06	50.8	784	0.115	0.055	TLR2_MOUSE Toll-like receptor 2 OS=Mus musculus OX=10090 GN=Tlr2 PE=1 SV=1
9	Q6TS42	1.03e-05	50.1	788	0.197	0.094	Q6TS42_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=2 SV=1
10	F1QWS9	1.11e-05	49.7	818	0.197	0.090	F1QWS9_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=3 SV=1
11	Q9EPQ1	2.47e-05	48.9	795	0.149	0.070	TLR1_MOUSE Toll-like receptor 1 OS=Mus musculus OX=10090 GN=Tlr1 PE=1 SV=1
12	Q15399	4.83e-05	47.8	786	0.149	0.071	TLR1_HUMAN Toll-like receptor 1 OS=Homo sapiens OX=9606 GN=TLR1 PE=1 SV=3
13	E9PTL5	2.40e-04	45.4	808	0.139	0.064	E9PTL5_RAT Toll-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Tlr1 PE=3 SV=3
14	Q9VPF0	0.001	43.1	1535	0.187	0.046	ATK_DROME Protein artichoke OS=Drosophila melanogaster OX=7227 GN=atk PE=1 SV=2
15	Q24020	0.003	42.4	1256	0.093	0.028	FLII_DROME Protein flightless-1 OS=Drosophila melanogaster OX=7227 GN=fliI PE=2 SV=1
16	Q6P3Y9	0.003	42.0	559	0.085	0.057	PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus OX=10090 GN=Podnl1 PE=1 SV=3
17	Q91XL1	0.003	41.6	342	0.144	0.158	Q91XL1_MOUSE Leucine-rich HEV glycoprotein OS=Mus musculus OX=10090 GN=Lrg1 PE=1 SV=1
18	O60603	0.008	40.8	784	0.189	0.091	TLR2_HUMAN Toll-like receptor 2 OS=Homo sapiens OX=9606 GN=TLR2 PE=1 SV=1
19	Q6R2J8	0.010	40.4	703	0.107	0.057	SRF8_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsis thaliana OX=3702 GN=SRF8 PE=1 SV=1
20	A0A096MKA9	0.015	40.0	806	0.080	0.037	A0A096MKA9_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	4.4	19.0	Leucine Rich Repeat
2	PF12799 LRR_4	1.2e-05	36.8	Leucine Rich repeats (2 copies)
3	PF13516 LRR_6	0.37	22.0	Leucine Rich repeat
4	PF13855 LRR_8	4.3e-05	34.5	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304236

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363089	0.999	Toll-like receptor 4
2	9606.ENSP00000260010	0.997	Toll-like receptor 2
3	9606.ENSP00000284818	0.989	Lymphocyte antigen 96
4	9606.ENSP00000217407	0.985	Lipopolysaccharide-binding protein
5	9606.ENSP00000401399	0.971	Myeloid differentiation primary response protein MyD88
6	9606.ENSP00000354932	0.969	Toll-like receptor 1
7	9606.ENSP00000389600	0.963	Toll-like receptor 6
8	9606.ENSP00000369286	0.956	Lymphocyte antigen 86
9	9606.ENSP00000482457	0.951	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
10	9606.ENSP00000441691	0.948	Integrin alpha-M
11	9606.ENSP00000379350	0.941	Integrin beta-1
12	9606.ENSP00000373620	0.927	60 kDa heat shock protein, mitochondrial
13	9606.ENSP00000358997	0.926	Interleukin-1 receptor-associated kinase 1
14	9606.ENSP00000433623	0.926	TNF receptor-associated factor 6
15	9606.ENSP00000376445	0.925	Toll/interleukin-1 receptor domain-containing adapter protein
16	9606.ENSP00000380227	0.921	Integrin alpha-4
17	9606.ENSP00000256447	0.918	CD180 antigen
18	9606.ENSP00000265077	0.910	Versican core protein
19	9606.ENSP00000314733	0.910	Toll-interacting protein
20	9606.ENSP00000327336	0.904	Biglycan

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.982	signaling receptor activity
GO:0008289	0.965	lipid binding
GO:0097367	0.866	carbohydrate derivative binding
GO:0070891	0.850	lipoteichoic acid binding
GO:0004888	0.843	transmembrane signaling receptor activity
GO:0038187	0.842	pattern recognition receptor activity
GO:0001530	0.841	lipopolysaccharide binding
GO:0016019	0.383	peptidoglycan immune receptor activity
GO:0001847	0.383	opsonin receptor activity
GO:0001875	0.371	lipopolysaccharide immune receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050896	0.993	response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0019222	0.988	regulation of metabolic process
GO:0002376	0.987	immune system process
GO:0002253	0.984	activation of immune response
GO:0002764	0.980	immune response-regulating signaling pathway
GO:0001817	0.977	regulation of cytokine production
GO:0051707	0.976	response to other organism
GO:0002757	0.971	immune response-activating signaling pathway
GO:0002758	0.964	innate immune response-activating signaling pathway
GO:0042221	0.959	response to chemical
GO:0051240	0.956	positive regulation of multicellular organismal process
GO:0001819	0.949	positive regulation of cytokine production
GO:0007166	0.946	cell surface receptor signaling pathway
GO:0070887	0.935	cellular response to chemical stimulus
GO:0071219	0.926	cellular response to molecule of bacterial origin
GO:0071310	0.925	cellular response to organic substance
GO:0032496	0.918	response to lipopolysaccharide
GO:0071222	0.912	cellular response to lipopolysaccharide
GO:0051179	0.872	localization
GO:0016192	0.861	vesicle-mediated transport
GO:0002221	0.852	pattern recognition receptor signaling pathway
GO:1903555	0.802	regulation of tumor necrosis factor superfamily cytokine production
GO:0032680	0.776	regulation of tumor necrosis factor production
GO:0048522	0.771	positive regulation of cellular process
GO:0032760	0.771	positive regulation of tumor necrosis factor production
GO:0032677	0.746	regulation of interleukin-8 production
GO:0006909	0.655	phagocytosis
GO:0008219	0.623	cell death
GO:0002768	0.497	immune response-regulating cell surface receptor signaling pathway
GO:0006950	0.476	response to stress
GO:0002429	0.469	immune response-activating cell surface receptor signaling pathway
GO:0032757	0.458	positive regulation of interleukin-8 production
GO:0012501	0.420	programmed cell death
GO:0006952	0.410	defense response
GO:0002220	0.328	innate immune response activating cell surface receptor signaling pathway
GO:0009966	0.319	regulation of signal transduction
GO:0006915	0.306	apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	1.000	cell surface
GO:0005886	1.000	plasma membrane
GO:0043227	0.999	membrane-bounded organelle
GO:0032991	0.998	protein-containing complex
GO:0012505	0.996	endomembrane system
GO:0005576	0.995	extracellular region
GO:0031982	0.993	vesicle
GO:0005615	0.982	extracellular space
GO:0005737	0.975	cytoplasm
GO:0043229	0.974	intracellular organelle
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0031090	0.926	organelle membrane
GO:0030659	0.915	cytoplasmic vesicle membrane
GO:0070062	0.909	extracellular exosome
GO:0098588	0.906	bounding membrane of organelle
GO:0098552	0.872	side of membrane
GO:0045121	0.868	membrane raft
GO:0099503	0.865	secretory vesicle
GO:0030141	0.853	secretory granule
GO:0098796	0.775	membrane protein complex
GO:0043235	0.760	receptor complex
GO:0009897	0.752	external side of plasma membrane
GO:0005768	0.650	endosome
GO:0030667	0.597	secretory granule membrane
GO:0010008	0.587	endosome membrane
GO:0005794	0.523	Golgi apparatus
GO:0046696	0.475	lipopolysaccharide receptor complex
GO:0005829	0.328	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]