StarFunc result for job id P08572

User Input

>input (1712 residues)
MGRDQRAVAGPALRRWLLLGTVTVGFLAQSVLAGVKKFDVPCGGRDCSGGCQCYPEKGGR
GQPGPVGPQGYNGPPGLQGFPGLQGRKGDKGERGAPGVTGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGRPGYDGCNGTQGDSGPQGPPGSEGFTGPPGPQGPKGQKGEPYALPKEERD
RYRGEPGEPGLVGFQGPPGRPGHVGQMGPVGAPGRPGPPGPPGPKGQQGNRGLGFYGVKG
EKGDVGQPGPNGIPSDTLHPIIAPTGVTFHPDQYKGEKGSEGEPGIRGISLKGEEGIMGF
PGLRGYPGLSGEKGSPGQKGSRGLDGYQGPDGPRGPKGEAGDPGPPGLPAYSPHPSLAKG
ARGDPGFPGAQGEPGSQGEPGDPGLPGPPGLSIGDGDQRRGLPGEMGPKGFIGDPGIPAL
YGGPPGPDGKRGPPGPPGLPGPPGPDGFLFGLKGAKGRAGFPGLPGSPGARGPKGWKGDA
GECRCTEGDEAIKGLPGLPGPKGFAGINGEPGRKGDRGDPGQHGLPGFPGLKGVPGNIGA
PGPKGAKGDSRTITTKGERGQPGVPGVPGMKGDDGSPGRDGLDGFPGLPGPPGDGIKGPP
GDPGYPGIPGTKGTPGEMGPPGLGLPGLKGQRGFPGDAGLPGPPGFLGPPGPAGTPGQID
CDTDVKRAVGGDRQEAIQPGCIGGPKGLPGLPGPPGPTGAKGLRGIPGFAGADGGPGPRG
LPGDAGREGFPGPPGFIGPRGSKGAVGLPGPDGSPGPIGLPGPDGPPGERGLPGEVLGAQ
PGPRGDAGVPGQPGLKGLPGDRGPPGFRGSQGMPGMPGLKGQPGLPGPSGQPGLYGPPGL
HGFPGAPGQEGPLGLPGIPGREGLPGDRGDPGDTGAPGPVGMKGLSGDRGDAGFTGEQGH
PGSPGFKGIDGMPGTPGLKGDRGSPGMDGFQGMPGLKGRPGFPGSKGEAGFFGIPGLKGL
AGEPGFKGSRGDPGPPGPPPVILPGMKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLS
GIPGLPGRPGHIKGVKGDIGVPGIPGLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGL
YGEIGATGDFGDIGDTINLPGRPGLKGERGTTGIPGLKGFFGEKGTEGDIGFPGITGVTG
VQGPPGLKGQTGFPGLTGPPGSQGELGRIGLPGGKGDDGWPGAPGLPGFPGLRGIRGLHG
LPGTKGFPGSPGSDIHGDPGFPGPPGERGDPGEANTLPGPVGVPGQKGDQGAPGERGPPG
SPGLQGFPGITPPSNISGAPGDKGAPGIFGLKGYRGPPGPPGSAALPGSKGDTGNPGAPG
TPGTKGWAGDSGPQGRPGVFGLPGEKGPRGEQGFMGNTGPTGAVGDRGPKGPKGDPGFPG
APGTVGAPGIAGIPQKIAVQPGTVGPQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQ
GRGGVSAVPGFRGDEGPIGHQGPIGQEGAPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQ
EPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASR
NDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAIAIAVHSQDVSIPHCPAGWRSLW
IGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIP
EQSFQGSPSADTLKAGLIRTHISRCQVCMKNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1M6Q3	0.181	0.187	0.000	1645	0.814	0.847	F1M6Q3.pdb.gz	F1M6Q3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=4
2	AFDB:P08572	1.000	1.000	0.000	1712	1.000	1.000	P08572.pdb.gz	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
3	AFDB:Q14031	0.188	0.190	2.813E-72	1691	0.512	0.519	Q14031.pdb.gz	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
4	AFDB:B1AVK5	0.167	0.169	5.325E-71	1691	0.507	0.513	B1AVK5.pdb.gz	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
5	AFDB:F1QYN1	0.182	0.182	2.905E-70	1714	0.506	0.505	F1QYN1.pdb.gz
6	AFDB:Q9QZR9	0.157	0.159	1.746E-63	1682	0.501	0.510	Q9QZR9.pdb.gz	CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus OX=10090 GN=Col4a4 PE=1 SV=1
7	AFDB:P53420	0.142	0.143	6.412E-63	1690	0.499	0.506	P53420.pdb.gz	CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens OX=9606 GN=COL4A4 PE=1 SV=3
8	AFDB:P17140	0.153	0.150	5.367E-60	1758	0.491	0.478	P17140.pdb.gz	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
9	AFDB:F1MA59	0.139	0.142	5.772E-59	1669	0.481	0.494	F1MA59.pdb.gz	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
10	AFDB:Q63ZW6	0.157	0.159	1.156E-57	1691	0.481	0.487	Q63ZW6.pdb.gz	Q63ZW6_MOUSE Col4a5 protein OS=Mus musculus OX=10090 GN=Col4a5 PE=1 SV=1
11	PDB:4v96AS	0.022	0.077	2.438E-1	242	0.016	0.112	4v96AS.pdb.gz
12	PDB:5k1bA	0.027	0.100	7.140E-1	264	0.009	0.061	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
13	PDB:5njxA	0.026	0.071	1.123	413	0.013	0.056	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
14	PDB:7bvfA	0.028	0.035	1.257	1087	0.016	0.025	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
15	PDB:5m1jA6	0.036	0.075	1.668	539	0.014	0.045	5m1jA6.pdb.gz	Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
16	PDB:6xtx4	0.026	0.053	1.976	598	0.011	0.030	6xtx4.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
17	PDB:5iz5B	0.027	0.049	2.342	746	0.012	0.028	5iz5B.pdb.gz
18	PDB:6rax7	0.026	0.055	2.342	632	0.007	0.019	6rax7.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
19	PDB:3ve2A	0.034	0.081	2.478	514	0.009	0.031	3ve2A.pdb.gz
20	PDB:7bhqB	0.023	0.109	2.478	204	0.006	0.049	7bhqB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AHV3	0.0	2160	1678	0.828	0.845	A0A8I6AHV3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=1
2	A0A8I6AVZ9	0.0	1917	1619	0.761	0.805	A0A8I6AVZ9_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=1
3	B1AVK5	0.0	924	1691	0.511	0.517	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
4	F1KQQ4	0.0	616	1759	0.439	0.428	F1KQQ4_ASCSU Collagen alpha-1(IV) chain (Fragment) OS=Ascaris suum OX=6253 PE=2 SV=1
5	F1M6Q3	0.0	2219	1707	0.843	0.845	F1M6Q3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=4
6	F1RLL9	0.0	2181	1712	0.851	0.851	F1RLL9_PIG Collagen type IV alpha 2 chain OS=Sus scrofa OX=9823 GN=COL4A2 PE=1 SV=3
7	O18407	0.0	636	1761	0.411	0.399	O18407_DROME Collagen type IV alpha 2 OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
8	P08120	0.0	820	1779	0.463	0.446	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
9	P08122	0.0	2244	1707	0.836	0.839	CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus OX=10090 GN=Col4a2 PE=1 SV=4
10	P08572	0.0	3123	1712	1.000	1.000	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
11	P17139	0.0	752	1759	0.454	0.442	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
12	Q9ESQ1	0.0	919	1691	0.509	0.515	Q9ESQ1_MOUSE Type IV collagen alpha 6 chain OS=Mus musculus OX=10090 GN=Col4a6 PE=2 SV=1
13	Q9VMV5	0.0	647	1940	0.425	0.375	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
14	F1MA59	1.43e-176	579	1669	0.299	0.307	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
15	P02463	3.98e-176	578	1669	0.297	0.305	CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus OX=10090 GN=Col4a1 PE=1 SV=4
16	P02462	1.47e-172	568	1669	0.323	0.331	CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens OX=9606 GN=COL4A1 PE=1 SV=4
17	Q14031	1.48e-131	453	1691	0.403	0.408	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
18	Q9QZS0	4.62e-130	448	1669	0.323	0.331	CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus OX=10090 GN=Col4a3 PE=1 SV=2
19	Q01955	1.63e-122	426	1670	0.244	0.250	CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens OX=9606 GN=COL4A3 PE=1 SV=3
20	A0A8I6AFK7	2.84e-107	380	1562	0.249	0.273	A0A8I6AFK7_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01413 C4	9.6e-79	272.4	C-terminal tandem repeated domain in type 4 procollagen
2	PF01391 Collagen	1.1e-179	593.7	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353654

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364979	0.999	Collagen alpha-1(IV) chain
2	9606.ENSP00000379350	0.948	Integrin beta-1
3	9606.ENSP00000452786	0.947	Integrin beta-3
4	9606.ENSP00000261023	0.943	Integrin alpha-V
5	9606.ENSP00000282588	0.935	Integrin alpha-1
6	9606.ENSP00000384999	0.929	Prolyl 4-hydroxylase subunit alpha-2
7	9606.ENSP00000296585	0.927	Integrin alpha-2
8	9606.ENSP00000331902	0.925	Collagen alpha-5(IV) chain
9	9606.ENSP00000263556	0.923	Prolyl 4-hydroxylase subunit alpha-1
10	9606.ENSP00000370542	0.919	Syndecan-1
11	9606.ENSP00000378340	0.918	Collagen alpha-6(IV) chain
12	9606.ENSP00000379823	0.918	Collagen alpha-3(IV) chain
13	9606.ENSP00000434412	0.918	Serpin H1
14	9606.ENSP00000379866	0.915	Collagen alpha-4(IV) chain
15	9606.ENSP00000354238	0.911	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
16	9606.ENSP00000226284	0.910	Bone sialoprotein 2
17	9606.ENSP00000351273	0.907	Caspase-8
18	9606.ENSP00000355361	0.905	Leukocyte surface antigen CD47
19	9606.ENSP00000253496	0.903	Coagulation factor XII
20	9606.ENSP00000363973	0.902	Alkaline phosphatase, tissue-nonspecific isozyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030020	0.999	extracellular matrix structural constituent conferring tensile strength

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.989	developmental process
GO:0009987	0.987	cellular process
GO:0050896	0.973	response to stimulus
GO:0065007	0.965	biological regulation
GO:0032501	0.955	multicellular organismal process
GO:0048856	0.953	anatomical structure development
GO:0050789	0.910	regulation of biological process
GO:0050794	0.827	regulation of cellular process
GO:0007275	0.812	multicellular organism development
GO:0048519	0.671	negative regulation of biological process
GO:0051239	0.645	regulation of multicellular organismal process
GO:0009653	0.639	anatomical structure morphogenesis
GO:0014823	0.605	response to activity
GO:0007568	0.603	aging
GO:0009888	0.555	tissue development
GO:0030154	0.454	cell differentiation
GO:0050793	0.438	regulation of developmental process
GO:0071840	0.433	cellular component organization or biogenesis
GO:0008152	0.422	metabolic process
GO:0051716	0.396	cellular response to stimulus
GO:0023052	0.381	signaling
GO:0007165	0.371	signal transduction
GO:0048646	0.334	anatomical structure formation involved in morphogenesis
GO:0016043	0.333	cellular component organization
GO:0071704	0.324	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0032991	0.998	protein-containing complex
GO:0005581	0.981	collagen trimer
GO:0099080	0.977	supramolecular complex
GO:0099081	0.973	supramolecular polymer
GO:0005604	0.973	basement membrane
GO:0098644	0.969	complex of collagen trimers
GO:0005587	0.960	collagen type IV trimer
GO:0043227	0.950	membrane-bounded organelle
GO:0005615	0.940	extracellular space
GO:0005737	0.937	cytoplasm
GO:0043231	0.927	intracellular membrane-bounded organelle
GO:0012505	0.919	endomembrane system
GO:0070013	0.822	intracellular organelle lumen
GO:0031982	0.624	vesicle
GO:0016020	0.592	membrane
GO:0005788	0.565	endoplasmic reticulum lumen
GO:0070062	0.503	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]