StarFunc result for job id P08574

User Input

>input (325 residues)
MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVM
LSALGMLAAGGAGLAMALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYP
NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLV
PLVYTIKRHKWSVLKSRKLAYRPPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZFQ8	0.859	0.857	1.611E-52	326	0.902	0.899	D3ZFQ8.pdb.gz	D3ZFQ8_RAT Cytochrome c-1 OS=Rattus norvegicus OX=10116 GN=Cyc1 PE=3 SV=4
2	AFDB:Q9VRL0	0.708	0.749	3.116E-37	307	0.526	0.557	Q9VRL0.pdb.gz	Q9VRL0_DROME Cytochrome c1, isoform A OS=Drosophila melanogaster OX=7227 GN=Cyt-c1 PE=1 SV=1
3	AFDB:Q9FKS5	0.778	0.822	1.821E-36	307	0.477	0.505	Q9FKS5.pdb.gz	CYC1B_ARATH Cytochrome c1 2, heme protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CYC1-2 PE=1 SV=1
4	AFDB:O59680	0.733	0.775	2.363E-35	307	0.443	0.469	O59680.pdb.gz	CY1_SCHPO Cytochrome c1, heme protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cyt1 PE=3 SV=1
5	AFDB:P07143	0.735	0.772	6.973E-35	309	0.471	0.495	P07143.pdb.gz	CY1_YEAST Cytochrome c1, heme protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYT1 PE=1 SV=1
6	AFDB:A0A1D8PHA3	0.736	0.829	7.382E-35	288	0.458	0.517	A0A1D8PHA3.pdb.gz	A0A1D8PHA3_CANAL Ubiquinol--cytochrome-c reductase catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CYT1 PE=1 SV=1
7	AFDB:Q18853	0.727	0.827	6.805E-34	285	0.431	0.491	Q18853.pdb.gz	Q18853_CAEEL Cytochrome c domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cyc-1 PE=1 SV=1
8	PDB:6giqD	0.729	0.951	7.574E-33	248	0.434	0.569	6giqD.pdb.gz	Cryo-EM structure of the yeast respiratory supercomplex.
9	PDB:7rjaD	0.721	0.953	1.994E-32	244	0.440	0.586	7rjaD.pdb.gz	Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.
10	AFDB:D6XKS6	0.646	0.806	5.163E-25	258	0.298	0.376	D6XKS6.pdb.gz	D6XKS6_TRYB2 Cytochrome c1, heme protein, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.340 PE=4 SV=1
11	AFDB:Q6PI78	0.069	0.090	4.049E-1	240	0.089	0.121	Q6PI78.pdb.gz	TMM65_HUMAN Transmembrane protein 65 OS=Homo sapiens OX=9606 GN=TMEM65 PE=1 SV=2
12	AFDB:Q07825	0.090	0.042	4.286E-1	749	0.092	0.040	Q07825.pdb.gz	FRA1_YEAST Putative Xaa-Pro aminopeptidase FRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRA1 PE=1 SV=1
13	PDB:5djqB	0.170	0.255	8.640E-1	197	0.083	0.137	5djqB.pdb.gz	The structure of cbb3 cytochrome oxidase provides insights into proton pumping.
14	PDB:4qccA	0.119	0.138	2.699	270	0.031	0.037	4qccA.pdb.gz
15	PDB:5b48A	0.090	0.060	3.390	576	0.040	0.023	5b48A.pdb.gz	Crystal structures of archaeal 2-oxoacid:ferredoxin oxidoreductases from Sulfolobus tokodaii
16	PDB:1dfoB	0.068	0.055	3.588	417	0.022	0.017	1dfoB.pdb.gz	Crystal structure at 2.4 A resolution of E. coli serine hydroxymethyltransferase in complex with glycine substrate and 5-formyl tetrahydrofolate.
17	PDB:3h7fB	0.074	0.059	3.799	428	0.022	0.016	3h7fB.pdb.gz
18	PDB:4n78F	0.121	0.215	4.770	156	0.031	0.064	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
19	PDB:7tveF	0.118	0.136	5.050	270	0.040	0.048	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
20	PDB:5n9jE	0.102	0.136	5.346	201	0.043	0.070	5n9jE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZFQ8	0.0	514	330	0.883	0.870	D3ZFQ8_RAT Cytochrome c-1 OS=Rattus norvegicus OX=10116 GN=Cyc1 PE=3 SV=4
2	P08574	0.0	665	325	1.000	1.000	CY1_HUMAN Cytochrome c1, heme protein, mitochondrial OS=Homo sapiens OX=9606 GN=CYC1 PE=1 SV=3
3	Q9D0M3	0.0	521	325	0.905	0.905	CY1_MOUSE Cytochrome c1, heme protein, mitochondrial OS=Mus musculus OX=10090 GN=Cyc1 PE=1 SV=1
4	Q9VRL0	6.84e-122	354	307	0.511	0.541	Q9VRL0_DROME Cytochrome c1, isoform A OS=Drosophila melanogaster OX=7227 GN=Cyt-c1 PE=1 SV=1
5	O59680	9.18e-108	318	307	0.446	0.472	CY1_SCHPO Cytochrome c1, heme protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cyt1 PE=3 SV=1
6	P07143	3.89e-104	309	309	0.465	0.489	CY1_YEAST Cytochrome c1, heme protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYT1 PE=1 SV=1
7	A0A1D8PHA3	2.72e-102	303	288	0.446	0.503	A0A1D8PHA3_CANAL Ubiquinol--cytochrome-c reductase catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CYT1 PE=1 SV=1
8	Q9FKS5	3.53e-99	296	307	0.480	0.508	CYC1B_ARATH Cytochrome c1 2, heme protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CYC1-2 PE=1 SV=1
9	Q9LK29	1.52e-98	295	307	0.483	0.511	CYC1A_ARATH Cytochrome c1 1, heme protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CYC1-1 PE=1 SV=1
10	Q18853	7.67e-77	238	285	0.431	0.491	Q18853_CAEEL Cytochrome c domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cyc-1 PE=1 SV=1
11	D6XKS6	5.28e-54	179	258	0.295	0.372	D6XKS6_TRYB2 Cytochrome c1, heme protein, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.340 PE=4 SV=1
12	O97134	5.28e-54	179	258	0.295	0.372	O97134_9TRYP Apocytochrome c1 OS=Trypanosoma brucei OX=5691 PE=4 SV=1
13	O92972	0.10	37.0	3010	0.105	0.011	POLG_HCVJ4 Genome polyprotein OS=Hepatitis C virus genotype 1b (strain HC-J4) OX=420174 PE=1 SV=2
14	Q9I238	3.9	32.0	634	0.040	0.021	Q9I238_PSEAE Cytochrome c OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA2077 PE=4 SV=1
15	Q7T2E7	4.7	30.8	222	0.049	0.072	Q7T2E7_DANRE Claudin OS=Danio rerio OX=7955 GN=cldn15l PE=2 SV=1
16	Q8IBI5	5.3	31.2	553	0.071	0.042	Q8IBI5_PLAF7 Cysteine desulfurase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0727200 PE=3 SV=1
17	P26662	6.8	31.2	3010	0.089	0.010	POLG_HCVJA Genome polyprotein OS=Hepatitis C virus genotype 1b (isolate Japanese) OX=11116 PE=1 SV=3
18	O93077	6.9	31.2	3010	0.098	0.011	O93077_9HEPC Genome polyprotein OS=Hepacivirus hominis OX=3052230 PE=1 SV=1
19	P26663	7.4	31.2	3010	0.089	0.010	POLG_HCVBK Genome polyprotein OS=Hepatitis C virus genotype 1b (isolate BK) OX=11105 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13442 Cytochrome_CBB3	18	17.0	Cytochrome C oxidase, cbb3-type, subunit III
2	PF00034 Cytochrom_C	1.2e+02	15.2	Cytochrome c
3	PF02167 Cytochrom_C1	8e-93	321.7	Cytochrome C1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317159

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000203407	0.999	Cytochrome b-c1 complex subunit 1, mitochondrial
2	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
3	9606.ENSP00000268379	0.999	Cytochrome b-c1 complex subunit 2, mitochondrial
4	9606.ENSP00000306397	0.999	Cytochrome b-c1 complex subunit Rieske, mitochondrial
5	9606.ENSP00000307786	0.999	Cytochrome c
6	9606.ENSP00000309565	0.999	Cytochrome b-c1 complex subunit 6, mitochondrial
7	9606.ENSP00000317780	0.999	Cytochrome c oxidase subunit 5A, mitochondrial
8	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
9	9606.ENSP00000332887	0.999	Cytochrome b-c1 complex subunit 9
10	9606.ENSP00000354554	0.999	Cytochrome b
11	9606.ENSP00000356972	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
12	9606.ENSP00000367939	0.999	Cytochrome b-c1 complex subunit 8
13	9606.ENSP00000430494	0.999	Cytochrome b-c1 complex subunit 7
14	9606.ENSP00000467262	0.999	Cytochrome b-c1 complex subunit 10
15	9606.ENSP00000215565	0.998	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
16	9606.ENSP00000252711	0.998	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
17	9606.ENSP00000258424	0.998	Cytochrome c oxidase subunit 5B, mitochondrial
18	9606.ENSP00000262030	0.998	ATP synthase subunit beta, mitochondrial
19	9606.ENSP00000315774	0.998	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
20	9606.ENSP00000327268	0.998	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0003824	0.687	catalytic activity
GO:0009055	0.660	electron transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.823	response to stimulus
GO:0009987	0.812	cellular process
GO:0008152	0.736	metabolic process
GO:1901698	0.634	response to nitrogen compound
GO:0044237	0.614	cellular metabolic process
GO:0010243	0.525	response to organonitrogen compound
GO:0071704	0.418	organic substance metabolic process
GO:0006091	0.377	generation of precursor metabolites and energy
GO:1901652	0.325	response to peptide
GO:0043434	0.311	response to peptide hormone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	0.996	mitochondrial membrane
GO:0019866	0.995	organelle inner membrane
GO:0005743	0.994	mitochondrial inner membrane
GO:0032991	0.985	protein-containing complex
GO:0098798	0.866	mitochondrial protein-containing complex
GO:0098796	0.849	membrane protein complex
GO:0070469	0.840	respirasome
GO:1902494	0.828	catalytic complex
GO:1990204	0.816	oxidoreductase complex
GO:0098803	0.813	respiratory chain complex
GO:0098800	0.802	inner mitochondrial membrane protein complex
GO:0005746	0.791	mitochondrial respirasome
GO:1902495	0.608	transmembrane transporter complex
GO:0070069	0.525	cytochrome complex
GO:0005634	0.368	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.660	Oxidoreductases.

[back to server]