StarFunc result for job id P08575

User Input

>input (1306 residues)
MTMYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPA
STFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSA
GTDTQTFSGSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAAL
PARTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYL
YNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVP
PGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLE
PEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFH
NFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTT
KSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFR
VKDLQYSTDYTFKAYFHNGDYPGEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYK
IYDLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSI
PRVFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPR
KYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVV
VKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNA
FSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEA
QYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQ
HIGNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINA
SFIMSYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGK
QTYGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISM
IQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQV
VKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDAN
CVNPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08575	1.000	1.000	0.000	1306	1.000	1.000	P08575.pdb.gz	PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens OX=9606 GN=PTPRC PE=1 SV=3
2	AFDB:P16620	0.422	0.378	7.274E-72	1462	0.218	0.195	P16620.pdb.gz	PTP69_DROME Tyrosine-protein phosphatase 69D OS=Drosophila melanogaster OX=7227 GN=Ptp69D PE=1 SV=2
3	AFDB:Q1MTF9	0.412	0.780	1.256E-62	677	0.197	0.380	Q1MTF9.pdb.gz	Q1MTF9_DANRE Receptor-type tyrosine-protein phosphatase OS=Danio rerio OX=7955 GN=si:dkey-46n18.4 PE=3 SV=1
4	AFDB:P23469	0.412	0.758	1.851E-61	700	0.196	0.366	P23469.pdb.gz	PTPRE_HUMAN Receptor-type tyrosine-protein phosphatase epsilon OS=Homo sapiens OX=9606 GN=PTPRE PE=1 SV=1
5	AFDB:Q64612	0.320	0.253	2.859E-57	1711	0.175	0.134	Q64612.pdb.gz	PTPRV_RAT Receptor-type tyrosine-protein phosphatase V OS=Rattus norvegicus OX=10116 GN=Ptprv PE=1 SV=1
6	AFDB:P23471	0.394	0.228	5.749E-48	2315	0.219	0.124	P23471.pdb.gz	PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens OX=9606 GN=PTPRZ1 PE=1 SV=4
7	AFDB:Q62656	0.394	0.228	1.363E-47	2316	0.224	0.127	Q62656.pdb.gz	PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1
8	AFDB:G5EGJ9	0.216	0.207	1.182E-42	1367	0.127	0.121	G5EGJ9.pdb.gz	DEP1_CAEEL Receptor-type tyrosine-protein phosphatase dep-1 OS=Caenorhabditis elegans OX=6239 GN=dep-1 PE=1 SV=1
9	PDB:3ps5A	0.208	0.501	1.992E-24	529	0.096	0.238	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
10	PDB:4gwfA	0.203	0.521	1.119E-23	497	0.086	0.225	4gwfA.pdb.gz
11	PDB:5xzrA	0.208	0.509	1.767E-23	519	0.096	0.243	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
12	PDB:6krwA	0.204	0.826	2.021E-22	306	0.074	0.314	6krwA.pdb.gz
13	AFDB:P28191	0.209	0.264	3.230E-22	1026	0.123	0.156	P28191.pdb.gz	PTP1_CAEEL Tyrosine-protein phosphatase 1 OS=Caenorhabditis elegans OX=6239 GN=ptp-1 PE=2 SV=3
14	AFDB:Q9H3S7	0.195	0.157	1.841E-19	1636	0.133	0.106	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
15	PDB:3m4uA	0.185	0.800	1.478E-16	285	0.065	0.298	3m4uA.pdb.gz
16	PDB:6pxvA	0.127	0.187	6.656E-15	823	0.037	0.058	6pxvA.pdb.gz
17	PDB:8eyyA	0.128	0.195	1.472E-13	775	0.036	0.061	8eyyA.pdb.gz
18	PDB:8dtlA	0.130	0.204	1.804E-13	741	0.034	0.061	8dtlA.pdb.gz
19	PDB:6pyhD	0.121	0.185	3.605E-12	798	0.038	0.063	6pyhD.pdb.gz
20	PDB:1e07A	0.131	0.231	6.162E-8	642	0.030	0.061	1e07A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04157	0.0	1662	1273	0.656	0.673	PTPRC_RAT Receptor-type tyrosine-protein phosphatase C OS=Rattus norvegicus OX=10116 GN=Ptprc PE=1 SV=2
2	P06800	0.0	1672	1293	0.673	0.680	PTPRC_MOUSE Receptor-type tyrosine-protein phosphatase C OS=Mus musculus OX=10090 GN=Ptprc PE=1 SV=4
3	P08575	0.0	2742	1306	1.000	1.000	PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens OX=9606 GN=PTPRC PE=1 SV=3
4	P18433	2.68e-154	486	802	0.203	0.330	PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA PE=1 SV=3
5	F1QE38	3.99e-151	479	831	0.192	0.302	F1QE38_DANRE Receptor-type tyrosine-protein phosphatase alpha OS=Danio rerio OX=7955 GN=RPTP[a] PE=1 SV=1
6	Q1MTF9	4.32e-151	473	677	0.190	0.366	Q1MTF9_DANRE Receptor-type tyrosine-protein phosphatase OS=Danio rerio OX=7955 GN=si:dkey-46n18.4 PE=3 SV=1
7	Q03348	3.22e-150	475	796	0.199	0.327	PTPRA_RAT Receptor-type tyrosine-protein phosphatase alpha OS=Rattus norvegicus OX=10116 GN=Ptpra PE=1 SV=1
8	P18052	7.88e-147	467	829	0.202	0.318	PTPRA_MOUSE Receptor-type tyrosine-protein phosphatase alpha OS=Mus musculus OX=10090 GN=Ptpra PE=1 SV=3
9	E7EZG7	5.72e-145	457	681	0.191	0.366	E7EZG7_DANRE Receptor-type tyrosine-protein phosphatase OS=Danio rerio OX=7955 GN=ptprea PE=3 SV=1
10	P23469	2.80e-139	443	700	0.189	0.353	PTPRE_HUMAN Receptor-type tyrosine-protein phosphatase epsilon OS=Homo sapiens OX=9606 GN=PTPRE PE=1 SV=1
11	P49446	8.86e-137	436	699	0.185	0.346	PTPRE_MOUSE Receptor-type tyrosine-protein phosphatase epsilon OS=Mus musculus OX=10090 GN=Ptpre PE=1 SV=3
12	B2GV87	3.53e-136	435	699	0.185	0.345	PTPRE_RAT Receptor-type tyrosine-protein phosphatase epsilon OS=Rattus norvegicus OX=10116 GN=Ptpre PE=2 SV=1
13	P16620	5.37e-121	412	1462	0.183	0.163	PTP69_DROME Tyrosine-protein phosphatase 69D OS=Drosophila melanogaster OX=7227 GN=Ptp69D PE=1 SV=2
14	Q64604	3.30e-119	412	1898	0.177	0.122	PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus OX=10116 GN=Ptprf PE=2 SV=1
15	A0A8I6A789	6.76e-119	407	1505	0.182	0.158	A0A8I6A789_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
16	A0A8I5ZQN2	8.40e-119	407	1506	0.189	0.164	A0A8I5ZQN2_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
17	P10586	8.77e-119	411	1907	0.178	0.122	PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2
18	A2A8L5	1.16e-118	410	1898	0.176	0.121	PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1
19	A0A8I6A6R5	9.82e-118	408	1920	0.182	0.124	A0A8I6A6R5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
20	P23468	1.03e-117	408	1912	0.183	0.125	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12567 CD45	2.6e-23	93.0	Leukocyte receptor CD45
2	PF00782 DSPc	2.1	19.6	Dual specificity phosphatase, catalytic domain
3	PF00041 fn3	4.5e-13	60.7	Fibronectin type III domain
4	PF08178 GnsAB_toxin	63	14.9	GnsA/GnsB toxin of bacterial toxin-antitoxin system
5	PF14566 PTPlike_phytase	0.0024	29.5	Inositol hexakisphosphate
6	PF12453 PTP_N	2.6e-13	60.7	Protein tyrosine phosphatase N terminal
7	PF15050 SCIMP	9.9e+02	11.5	SCIMP protein
8	PF10149 TM231	4.1e+02	11.6	Transmembrane protein 231
9	PF00102 Y_phosphatase	6.5e-156	528.4	Protein-tyrosine phosphatase
10	PF03162 Y_phosphatase2	32	15.5	Tyrosine phosphatase family
11	PF13350 Y_phosphatase3	0.00059	31.5	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411355

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000085219	0.999	B-cell receptor CD22
2	9606.ENSP00000337825	0.999	Tyrosine-protein kinase Lck
3	9606.ENSP00000416523	0.997	Semaphorin-4D
4	9606.ENSP00000386884	0.996	C-X-C chemokine receptor type 4
5	9606.ENSP00000011653	0.995	T-cell surface glycoprotein CD4
6	9606.ENSP00000325589	0.993	Protein tyrosine phosphatase, receptor type C associated protein
7	9606.ENSP00000353731	0.991	Dipeptidyl peptidase 4
8	9606.ENSP00000358490	0.991	T-cell surface antigen CD2
9	9606.ENSP00000428924	0.991	Tyrosine-protein kinase Lyn
10	9606.ENSP00000354566	0.987	T-cell surface glycoprotein CD3 epsilon chain
11	9606.ENSP00000354782	0.986	T-cell surface glycoprotein CD3 zeta chain
12	9606.ENSP00000346671	0.985	Tyrosine-protein kinase Fyn
13	9606.ENSP00000221972	0.984	B-cell antigen receptor complex-associated protein alpha chain
14	9606.ENSP00000254301	0.983	Galectin-3
15	9606.ENSP00000376544	0.975	B-cell antigen receptor complex-associated protein beta chain
16	9606.ENSP00000379140	0.969	Stromal cell-derived factor 1
17	9606.ENSP00000384371	0.967	B-cell lymphoma 6 protein
18	9606.ENSP00000390431	0.964	Major histocompatibility complex, class II, DQ beta 2
19	9606.ENSP00000046794	0.963	Lymphocyte cytosolic protein 2
20	9606.ENSP00000364080	0.960	HLA class II histocompatibility antigen, DQ beta 1 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005001	0.999	transmembrane receptor protein tyrosine phosphatase activity
GO:0019899	0.996	enzyme binding
GO:0044877	0.992	protein-containing complex binding
GO:0019900	0.992	kinase binding
GO:0019901	0.964	protein kinase binding
GO:0008092	0.949	cytoskeletal protein binding
GO:0030507	0.933	spectrin binding
GO:0030506	0.932	ankyrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0051716	0.984	cellular response to stimulus
GO:0048518	0.983	positive regulation of biological process
GO:0007154	0.977	cell communication
GO:0023052	0.975	signaling
GO:0007165	0.971	signal transduction
GO:0048522	0.968	positive regulation of cellular process
GO:0048583	0.965	regulation of response to stimulus
GO:0002682	0.963	regulation of immune system process
GO:0002376	0.957	immune system process
GO:0048584	0.954	positive regulation of response to stimulus
GO:0032501	0.950	multicellular organismal process
GO:0007166	0.950	cell surface receptor signaling pathway
GO:0002684	0.945	positive regulation of immune system process
GO:0032502	0.939	developmental process
GO:0048856	0.933	anatomical structure development
GO:0050852	0.929	T cell receptor signaling pathway
GO:0051249	0.920	regulation of lymphocyte activation
GO:0050867	0.918	positive regulation of cell activation
GO:0019222	0.917	regulation of metabolic process
GO:0001775	0.905	cell activation
GO:0001932	0.898	regulation of protein phosphorylation
GO:0046649	0.896	lymphocyte activation
GO:0002696	0.892	positive regulation of leukocyte activation
GO:0002697	0.884	regulation of immune effector process
GO:0002521	0.880	leukocyte differentiation
GO:0009893	0.867	positive regulation of metabolic process
GO:0010628	0.860	positive regulation of gene expression
GO:0051251	0.844	positive regulation of lymphocyte activation
GO:0042110	0.840	T cell activation
GO:1903131	0.839	mononuclear cell differentiation
GO:0048523	0.838	negative regulation of cellular process
GO:0023051	0.829	regulation of signaling
GO:0030155	0.829	regulation of cell adhesion
GO:0050790	0.822	regulation of catalytic activity
GO:0007275	0.822	multicellular organism development
GO:0030098	0.821	lymphocyte differentiation
GO:0001817	0.820	regulation of cytokine production
GO:0010646	0.786	regulation of cell communication
GO:0008284	0.782	positive regulation of cell population proliferation
GO:0009966	0.745	regulation of signal transduction
GO:0048731	0.734	system development
GO:0009892	0.711	negative regulation of metabolic process
GO:0051173	0.705	positive regulation of nitrogen compound metabolic process
GO:0031325	0.697	positive regulation of cellular metabolic process
GO:0070663	0.675	regulation of leukocyte proliferation
GO:0045859	0.675	regulation of protein kinase activity
GO:0002683	0.673	negative regulation of immune system process
GO:0050670	0.658	regulation of lymphocyte proliferation
GO:0043086	0.634	negative regulation of catalytic activity
GO:0080134	0.633	regulation of response to stress
GO:0002699	0.629	positive regulation of immune effector process
GO:0070665	0.621	positive regulation of leukocyte proliferation
GO:0048585	0.613	negative regulation of response to stimulus
GO:0050730	0.607	regulation of peptidyl-tyrosine phosphorylation
GO:0006469	0.607	negative regulation of protein kinase activity
GO:0030217	0.606	T cell differentiation
GO:0032946	0.603	positive regulation of mononuclear cell proliferation
GO:0008152	0.601	metabolic process
GO:0032879	0.593	regulation of localization
GO:0002700	0.588	regulation of production of molecular mediator of immune response
GO:0002702	0.584	positive regulation of production of molecular mediator of immune response
GO:0050671	0.582	positive regulation of lymphocyte proliferation
GO:0048513	0.569	animal organ development
GO:0050864	0.524	regulation of B cell activation
GO:0030890	0.506	positive regulation of B cell proliferation
GO:0044237	0.475	cellular metabolic process
GO:0071704	0.466	organic substance metabolic process
GO:0002637	0.453	regulation of immunoglobulin production
GO:0033077	0.451	T cell differentiation in thymus
GO:0044238	0.421	primary metabolic process
GO:0006950	0.399	response to stress
GO:0042221	0.388	response to chemical
GO:0006807	0.382	nitrogen compound metabolic process
GO:0051247	0.336	positive regulation of protein metabolic process
GO:0043170	0.330	macromolecule metabolic process
GO:0032101	0.319	regulation of response to external stimulus
GO:1901564	0.309	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0009986	0.993	cell surface
GO:0012505	0.991	endomembrane system
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005737	0.987	cytoplasm
GO:0031982	0.966	vesicle
GO:0005576	0.943	extracellular region
GO:0031410	0.939	cytoplasmic vesicle
GO:0005615	0.914	extracellular space
GO:0098552	0.908	side of membrane
GO:0043230	0.691	extracellular organelle
GO:0065010	0.675	extracellular membrane-bounded organelle
GO:1903561	0.659	extracellular vesicle
GO:0070062	0.646	extracellular exosome
GO:0031090	0.553	organelle membrane
GO:0099503	0.455	secretory vesicle
GO:0030141	0.449	secretory granule
GO:0032059	0.383	bleb
GO:0009897	0.380	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]