StarFunc result for job id P08581

User Input

>input (1390 residues)
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
TRPASFWETS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QLR7	0.482	0.484	0.000	1382	0.510	0.513	F1QLR7.pdb.gz	F1QLR7_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=c-met PE=4 SV=1
2	AFDB:P08581	1.000	1.000	0.000	1390	1.000	1.000	P08581.pdb.gz	MET_HUMAN Hepatocyte growth factor receptor OS=Homo sapiens OX=9606 GN=MET PE=1 SV=4
3	AFDB:P97523	0.693	0.697	0.000	1382	0.875	0.880	P97523.pdb.gz	MET_RAT Hepatocyte growth factor receptor OS=Rattus norvegicus OX=10116 GN=Met PE=1 SV=1
4	AFDB:Q04912	0.397	0.394	0.000	1400	0.345	0.342	Q04912.pdb.gz	RON_HUMAN Macrophage-stimulating protein receptor OS=Homo sapiens OX=9606 GN=MST1R PE=1 SV=3
5	AFDB:Q9UIW2	0.307	0.230	1.259E-59	1896	0.170	0.124	Q9UIW2.pdb.gz	PLXA1_HUMAN Plexin-A1 OS=Homo sapiens OX=9606 GN=PLXNA1 PE=1 SV=3
6	AFDB:O75051	0.310	0.232	5.308E-59	1894	0.164	0.120	O75051.pdb.gz	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
7	AFDB:A0A2R8QPJ6	0.293	0.217	6.339E-58	1902	0.166	0.121	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
8	AFDB:Q9HCM2	0.295	0.220	7.000E-58	1894	0.163	0.119	Q9HCM2.pdb.gz	PLXA4_HUMAN Plexin-A4 OS=Homo sapiens OX=9606 GN=PLXNA4 PE=1 SV=4
9	AFDB:B0S5N4	0.316	0.237	2.419E-57	1892	0.163	0.119	B0S5N4.pdb.gz	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
10	AFDB:P70208	0.295	0.222	7.054E-56	1872	0.157	0.116	P70208.pdb.gz	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
11	PDB:6vxkB	0.247	0.434	9.177E-32	747	0.094	0.174	6vxkB.pdb.gz
12	PDB:1k9aB	0.175	0.537	5.572E-20	441	0.073	0.229	1k9aB.pdb.gz
13	PDB:6qp7A	0.286	0.576	1.116E-19	620	0.070	0.156	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
14	PDB:3nvqA	0.243	0.500	6.654E-19	588	0.058	0.136	3nvqA.pdb.gz
15	PDB:2h8hA	0.175	0.517	1.672E-17	445	0.070	0.218	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
16	PDB:4k2rA	0.175	0.429	2.746E-17	551	0.062	0.156	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
17	PDB:4fl2A	0.177	0.429	1.101E-16	555	0.068	0.171	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
18	PDB:2qkwB	0.164	0.699	2.159E-15	292	0.053	0.250	2qkwB.pdb.gz
19	PDB:8dksA	0.159	0.699	1.785E-13	283	0.053	0.261	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
20	PDB:2bujA	0.169	0.734	2.789E-13	291	0.044	0.210	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QLR7	0.0	1435	1382	0.513	0.516	F1QLR7_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=c-met PE=4 SV=1
2	P08581	0.0	2894	1390	1.000	1.000	MET_HUMAN Hepatocyte growth factor receptor OS=Homo sapiens OX=9606 GN=MET PE=1 SV=4
3	P16056	0.0	2596	1379	0.890	0.897	MET_MOUSE Hepatocyte growth factor receptor OS=Mus musculus OX=10090 GN=Met PE=1 SV=1
4	P97523	0.0	2533	1382	0.878	0.883	MET_RAT Hepatocyte growth factor receptor OS=Rattus norvegicus OX=10116 GN=Met PE=1 SV=1
5	Q04912	0.0	736	1400	0.345	0.342	RON_HUMAN Macrophage-stimulating protein receptor OS=Homo sapiens OX=9606 GN=MST1R PE=1 SV=3
6	Q62190	0.0	748	1378	0.351	0.354	RON_MOUSE Macrophage-stimulating protein receptor OS=Mus musculus OX=10090 GN=Mst1r PE=1 SV=3
7	Q64GK4	0.0	1429	1382	0.511	0.514	Q64GK4_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=cmet PE=2 SV=1
8	P57097	3.35e-68	252	994	0.094	0.131	MERTK_RAT Tyrosine-protein kinase Mer OS=Rattus norvegicus OX=10116 GN=Mertk PE=2 SV=1
9	Q12866	5.86e-68	251	999	0.100	0.139	MERTK_HUMAN Tyrosine-protein kinase Mer OS=Homo sapiens OX=9606 GN=MERTK PE=1 SV=2
10	Q9YI66	5.21e-67	246	874	0.096	0.153	TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio OX=7955 GN=tyro3 PE=2 SV=1
11	Q60805	5.72e-67	248	994	0.099	0.138	MERTK_MOUSE Tyrosine-protein kinase Mer OS=Mus musculus OX=10090 GN=Mertk PE=1 SV=1
12	P30530	2.66e-65	242	894	0.094	0.147	UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL PE=1 SV=4
13	E9PSX9	5.24e-64	237	858	0.089	0.145	E9PSX9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
14	A0A0G2K2H0	5.25e-64	238	879	0.089	0.141	A0A0G2K2H0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
15	Q06418	5.58e-64	238	890	0.090	0.140	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
16	Q8VI99	5.75e-64	238	879	0.089	0.141	Q8VI99_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=3 SV=1
17	Q8VIA0	6.78e-64	237	888	0.089	0.140	Q8VIA0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=3 SV=1
18	Q00993	8.83e-64	237	888	0.089	0.140	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
19	E9PSY0	1.21e-63	237	921	0.089	0.135	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
20	P55146	1.29e-63	236	880	0.089	0.141	TYRO3_RAT Tyrosine-protein kinase receptor TYRO3 OS=Rattus norvegicus OX=10116 GN=Tyro3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14531 Kinase-like	2.1	19.2	Kinase-like
2	PF00069 Pkinase	3.1e-36	136.7	Protein kinase domain
3	PF17667 Pkinase_fungal	2.2	18.6	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	1e-89	311.9	Protein tyrosine and serine/threonine kinase
5	PF01437 PSI	0.19	23.6	Plexin repeat
6	PF01403 Sema	2e-15	68.7	Sema domain
7	PF01833 TIG	1.3e-37	139.0	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000057112

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000033097	0.999	Hepatocyte growth factor
2	9598.ENSPTRP00000007497	0.998	Cas-Br-M (Murine) ecotropic retroviral transforming sequence
3	9598.ENSPTRP00000028277	0.995	GRB2-associated binding protein 1
4	9598.ENSPTRP00000016382	0.993	Pan troglodytes growth factor receptor-bound protein 2 (GRB2), mRNA
5	9598.ENSPTRP00000051735	0.985	SHC (Src homology 2 domain containing) transforming protein 1
6	9598.ENSPTRP00000044466	0.980	Catenin (Cadherin-associated protein), beta 1, 88kDa
7	9598.ENSPTRP00000026912	0.971	Phosphoinositide-3-kinase, catalytic, alpha polypeptide
8	9598.ENSPTRP00000023137	0.968	Tyrosine-protein kinase
9	9598.ENSPTRP00000025675	0.965	Plexin B1
10	9598.ENSPTRP00000008150	0.958	Uncharacterized protein
11	9598.ENSPTRP00000046318	0.958	Catenin delta 1
12	9598.ENSPTRP00000023178	0.955	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
13	9598.ENSPTRP00000005495	0.952	HRas proto-oncogene, GTPase
14	9598.ENSPTRP00000012048	0.929	Uncharacterized protein
15	9598.ENSPTRP00000036052	0.929	Uncharacterized protein
16	9598.ENSPTRP00000004110	0.925	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
17	9598.ENSPTRP00000035264	0.924	Belongs to the protein kinase superfamily. Tyr protein kinase family
18	9598.ENSPTRP00000014330	0.920	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
19	9598.ENSPTRP00000029009	0.920	Phosphoinositide-3-kinase, regulatory subunit 1 (Alpha)
20	9598.ENSPTRP00000014119	0.917	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004714	1.000	transmembrane receptor protein tyrosine kinase activity
GO:0019899	0.981	enzyme binding
GO:0042802	0.819	identical protein binding
GO:0098772	0.805	molecular function regulator activity
GO:0005102	0.673	signaling receptor binding
GO:0140677	0.662	molecular function activator activity
GO:0019903	0.617	protein phosphatase binding
GO:0005008	0.568	hepatocyte growth factor receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.990	response to stimulus
GO:0009987	0.990	cellular process
GO:0048518	0.983	positive regulation of biological process
GO:0048856	0.975	anatomical structure development
GO:0023052	0.971	signaling
GO:0032501	0.956	multicellular organismal process
GO:0051716	0.944	cellular response to stimulus
GO:0048522	0.942	positive regulation of cellular process
GO:0048583	0.941	regulation of response to stimulus
GO:0019222	0.941	regulation of metabolic process
GO:0048731	0.941	system development
GO:0048519	0.933	negative regulation of biological process
GO:0060255	0.925	regulation of macromolecule metabolic process
GO:0007154	0.906	cell communication
GO:0007165	0.897	signal transduction
GO:0048869	0.885	cellular developmental process
GO:0030154	0.880	cell differentiation
GO:0007166	0.873	cell surface receptor signaling pathway
GO:0010468	0.871	regulation of gene expression
GO:0051239	0.870	regulation of multicellular organismal process
GO:0042221	0.866	response to chemical
GO:0007399	0.852	nervous system development
GO:0016477	0.844	cell migration
GO:0048513	0.819	animal organ development
GO:0023051	0.795	regulation of signaling
GO:0051174	0.793	regulation of phosphorus metabolic process
GO:0010646	0.787	regulation of cell communication
GO:0019220	0.778	regulation of phosphate metabolic process
GO:0051171	0.769	regulation of nitrogen compound metabolic process
GO:0080090	0.767	regulation of primary metabolic process
GO:0010604	0.765	positive regulation of macromolecule metabolic process
GO:0050793	0.762	regulation of developmental process
GO:0040012	0.761	regulation of locomotion
GO:0051130	0.753	positive regulation of cellular component organization
GO:0009888	0.749	tissue development
GO:0030334	0.747	regulation of cell migration
GO:0048523	0.744	negative regulation of cellular process
GO:0033043	0.737	regulation of organelle organization
GO:0051247	0.723	positive regulation of protein metabolic process
GO:0009966	0.705	regulation of signal transduction
GO:0048584	0.696	positive regulation of response to stimulus
GO:0031399	0.696	regulation of protein modification process
GO:0065009	0.695	regulation of molecular function
GO:1902531	0.694	regulation of intracellular signal transduction
GO:0031325	0.688	positive regulation of cellular metabolic process
GO:0080134	0.670	regulation of response to stress
GO:0009605	0.665	response to external stimulus
GO:0008152	0.635	metabolic process
GO:0048468	0.631	cell development
GO:0006935	0.624	chemotaxis
GO:0048585	0.610	negative regulation of response to stimulus
GO:0001889	0.607	liver development
GO:0010941	0.569	regulation of cell death
GO:0071526	0.552	semaphorin-plexin signaling pathway
GO:0050918	0.550	positive chemotaxis
GO:0009889	0.533	regulation of biosynthetic process
GO:0019219	0.531	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.521	organic substance metabolic process
GO:0032101	0.509	regulation of response to external stimulus
GO:0044237	0.497	cellular metabolic process
GO:0044238	0.483	primary metabolic process
GO:0023056	0.481	positive regulation of signaling
GO:0031326	0.481	regulation of cellular biosynthetic process
GO:0010556	0.466	regulation of macromolecule biosynthetic process
GO:1902903	0.458	regulation of supramolecular fiber organization
GO:0050790	0.450	regulation of catalytic activity
GO:0080135	0.447	regulation of cellular response to stress
GO:0001932	0.445	regulation of protein phosphorylation
GO:0071840	0.439	cellular component organization or biogenesis
GO:0009653	0.425	anatomical structure morphogenesis
GO:0042127	0.420	regulation of cell population proliferation
GO:0044093	0.407	positive regulation of molecular function
GO:0016043	0.398	cellular component organization
GO:0045935	0.383	positive regulation of nucleobase-containing compound metabolic process
GO:0060548	0.381	negative regulation of cell death
GO:0051493	0.380	regulation of cytoskeleton organization
GO:0006807	0.377	nitrogen compound metabolic process
GO:0043067	0.374	regulation of programmed cell death
GO:2000147	0.360	positive regulation of cell motility
GO:0031401	0.350	positive regulation of protein modification process
GO:0010647	0.346	positive regulation of cell communication
GO:0045937	0.345	positive regulation of phosphate metabolic process
GO:0065008	0.343	regulation of biological quality
GO:0043170	0.338	macromolecule metabolic process
GO:0006355	0.335	regulation of DNA-templated transcription
GO:0009967	0.331	positive regulation of signal transduction
GO:0023057	0.328	negative regulation of signaling
GO:1901564	0.327	organonitrogen compound metabolic process
GO:0010648	0.327	negative regulation of cell communication
GO:0009891	0.322	positive regulation of biosynthetic process
GO:0009968	0.322	negative regulation of signal transduction
GO:0009892	0.308	negative regulation of metabolic process
GO:0070887	0.307	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.867	membrane-bounded organelle
GO:0005622	0.845	intracellular anatomical structure
GO:0005737	0.823	cytoplasm
GO:0098590	0.701	plasma membrane region
GO:0043229	0.514	intracellular organelle
GO:0043231	0.308	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]