StarFunc result for job id P08582

User Input

>input (738 residues)
MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSA
DHCVQLIAAQEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVT
IDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETS
YSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQ
RLFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGHEYLHAMKGLLCDPN
RLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTL
SGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGF
GSPAGWDVPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQ
GRNKCVGNSQERYYGYRGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYE
LLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKM
FDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQCSGAAAPAPGAP
LLPLLLPALAARLLPPAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08582	1.000	1.000	0.000	738	1.000	1.000	P08582.pdb.gz	TRFM_HUMAN Melanotransferrin OS=Homo sapiens OX=9606 GN=MELTF PE=1 SV=2
2	AFDB:P02788	0.362	0.374	1.932E-70	710	0.390	0.406	P02788.pdb.gz	TRFL_HUMAN Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6
3	AFDB:K9IMD0	0.351	0.364	3.322E-70	708	0.401	0.418	K9IMD0.pdb.gz	TRLF_DESRO Lactotransferrin OS=Desmodus rotundus OX=9430 GN=LTF PE=1 SV=1
4	AFDB:P08071	0.359	0.372	1.155E-69	707	0.373	0.389	P08071.pdb.gz	TRFL_MOUSE Lactotransferrin OS=Mus musculus OX=10090 GN=Ltf PE=1 SV=4
5	AFDB:P24627	0.365	0.378	2.336E-69	708	0.390	0.407	P24627.pdb.gz	TRFL_BOVIN Lactotransferrin OS=Bos taurus OX=9913 GN=LTF PE=1 SV=2
6	AFDB:P02787	0.359	0.377	2.040E-68	698	0.400	0.423	P02787.pdb.gz	TRFE_HUMAN Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=4
7	AFDB:Q921I1	0.354	0.372	1.435E-67	697	0.386	0.409	Q921I1.pdb.gz	TRFE_MOUSE Serotransferrin OS=Mus musculus OX=10090 GN=Tf PE=1 SV=1
8	AFDB:P12346	0.360	0.378	2.466E-67	698	0.386	0.408	P12346.pdb.gz	TRFE_RAT Serotransferrin OS=Rattus norvegicus OX=10116 GN=Tf PE=1 SV=3
9	PDB:2bjjX	0.348	0.368	7.552E-67	692	0.381	0.406	2bjjX.pdb.gz	The Protein Structure of Recombinant Human Lactoferrin Produced in the Milk of Transgenic Cows Closely Matches the Structure of Human Milk-Derived Lactoferrin
10	AFDB:P02789	0.350	0.364	1.124E-66	705	0.378	0.396	P02789.pdb.gz	TRFE_CHICK Ovotransferrin OS=Gallus gallus OX=9031 PE=1 SV=2
11	AFDB:Q9PT13	0.378	0.402	1.831E-66	691	0.360	0.385	Q9PT13.pdb.gz	Q9PT13_ONCMY Serotransferrin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
12	PDB:4h0wA	0.409	0.444	7.759E-66	679	0.390	0.424	4h0wA.pdb.gz	Iron and bismuth bound human serum transferrin reveals a partially-opened conformation in the N-lobe.
13	PDB:1blfA	0.337	0.359	9.636E-66	685	0.381	0.410	1blfA.pdb.gz	Three-dimensional structure of diferric bovine lactoferrin at 2.8 A resolution.
14	PDB:3mc2A	0.331	0.357	2.057E-57	675	0.340	0.372	3mc2A.pdb.gz
15	PDB:1aivA	0.406	0.436	2.356E-54	686	0.371	0.399	1aivA.pdb.gz
16	PDB:3s9mC	0.333	0.448	8.647E-40	517	0.280	0.400	3s9mC.pdb.gz	How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
17	PDB:3s9mD	0.308	0.437	3.089E-32	488	0.262	0.395	3s9mD.pdb.gz	How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
18	PDB:3s9nD	0.272	0.408	1.846E-25	457	0.243	0.392	3s9nD.pdb.gz	How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
19	PDB:4eswA	0.198	0.357	1.134E-5	342	0.039	0.085	4eswA.pdb.gz
20	PDB:2x26A	0.173	0.338	1.486E-5	308	0.041	0.097	2x26A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08582	0.0	1528	738	1.000	1.000	TRFM_HUMAN Melanotransferrin OS=Homo sapiens OX=9606 GN=MELTF PE=1 SV=2
2	K9IMD0	9.38e-156	470	708	0.405	0.422	TRLF_DESRO Lactotransferrin OS=Desmodus rotundus OX=9430 GN=LTF PE=1 SV=1
3	P02788	4.73e-154	466	710	0.396	0.411	TRFL_HUMAN Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6
4	P02787	1.72e-152	461	698	0.408	0.431	TRFE_HUMAN Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=4
5	Q06AH7	2.35e-152	461	698	0.408	0.431	Q06AH7_HUMAN Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=2 SV=1
6	P24627	4.88e-152	461	708	0.386	0.403	TRFL_BOVIN Lactotransferrin OS=Bos taurus OX=9913 GN=LTF PE=1 SV=2
7	B7ZAL5	6.55e-148	449	666	0.373	0.413	B7ZAL5_HUMAN cDNA, FLJ79229, highly similar to Lactotransferrin OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q9PT13	1.07e-145	444	691	0.388	0.414	Q9PT13_ONCMY Serotransferrin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
9	P08071	2.40e-144	441	707	0.383	0.400	TRFL_MOUSE Lactotransferrin OS=Mus musculus OX=10090 GN=Ltf PE=1 SV=4
10	Q921I1	2.64e-142	435	697	0.378	0.400	TRFE_MOUSE Serotransferrin OS=Mus musculus OX=10090 GN=Tf PE=1 SV=1
11	P12346	4.65e-142	435	698	0.379	0.401	TRFE_RAT Serotransferrin OS=Rattus norvegicus OX=10116 GN=Tf PE=1 SV=3
12	P02789	2.29e-138	425	705	0.375	0.393	TRFE_CHICK Ovotransferrin OS=Gallus gallus OX=9031 PE=1 SV=2
13	Q9DBD0	3.14e-126	394	700	0.358	0.377	ICA_MOUSE Inhibitor of carbonic anhydrase OS=Mus musculus OX=10090 GN=Inhca PE=1 SV=1
14	B8JL43	1.17e-115	365	673	0.331	0.363	B8JL43_DANRE Serotransferrin OS=Danio rerio OX=7955 GN=cb285 PE=1 SV=1
15	Q9VTZ5	2.00e-101	332	819	0.341	0.308	TRFM_DROME Transferrin 2 OS=Drosophila melanogaster OX=7227 GN=Tsf2 PE=1 SV=1
16	Q6P3G0	1.72e-89	292	520	0.266	0.377	Q6P3G0_DANRE Transferrin-a OS=Danio rerio OX=7955 GN=tfa PE=2 SV=2
17	Q0VIL3	2.39e-77	255	371	0.203	0.404	OTOMP_DANRE Otolith matrix protein 1 OS=Danio rerio OX=7955 GN=otomp PE=2 SV=1
18	A0PJA6	9.76e-40	146	180	0.117	0.478	A0PJA6_HUMAN TF protein (Fragment) OS=Homo sapiens OX=9606 GN=TF PE=2 SV=1
19	Q9VWV6	7.92e-20	96.7	641	0.103	0.119	Q9VWV6_DROME Transferrin OS=Drosophila melanogaster OX=7227 GN=Tsf1 PE=1 SV=1
20	O97355	1.49e-19	95.9	641	0.149	0.172	O97355_DROME Transferrin OS=Drosophila melanogaster OX=7227 GN=Tsf1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13969 Pab87_oct	2.8e+02	13.0	Pab87 octamerisation domain
2	PF12974 Phosphonate-bd	5.4e-15	67.2	ABC transporter, phosphonate, periplasmic substrate-binding protein
3	PF00497 SBP_bac_3	3.2	18.7	Bacterial extracellular solute-binding proteins, family 3
4	PF00405 Transferrin	7e-244	819.3	Transferrin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296350

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308720	0.715	Trypsin-1
2	9606.ENSP00000354280	0.715	Trypsin-3
3	9606.ENSP00000485444	0.715	Trypsin-2
4	9606.ENSP00000295256	0.695	Hematopoietic prostaglandin D synthase
5	9606.ENSP00000216254	0.680	Aconitate hydratase, mitochondrial
6	9606.ENSP00000420091	0.622	SLIT and NTRK-like protein 3
7	9606.ENSP00000216471	0.617	Sterile alpha motif domain containing 15
8	9606.ENSP00000353224	0.617	Transferrin receptor protein 1
9	9606.ENSP00000359321	0.612	Metal-response element-binding transcription factor 2
10	9606.ENSP00000315351	0.611	D-2-hydroxyglutarate dehydrogenase, mitochondrial
11	9606.ENSP00000308938	0.605	Plasminogen
12	9606.ENSP00000367292	0.598	Leucine-rich repeat transmembrane protein FLRT3
13	9606.ENSP00000416959	0.583	Transformer-2 protein homolog beta
14	9606.ENSP00000313691	0.572	Ferritin, mitochondrial
15	9606.ENSP00000378364	0.541	Natural resistance-associated macrophage protein 2
16	9606.ENSP00000361850	0.523	Urokinase-type plasminogen activator
17	9606.ENSP00000304236	0.518	Monocyte differentiation antigen CD14
18	9606.ENSP00000366482	0.514	Frataxin, mitochondrial
19	9606.ENSP00000376184	0.502	D-beta-hydroxybutyrate dehydrogenase, mitochondrial
20	9606.ENSP00000420525	0.501	Transferrin receptor protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005506	1.000	iron ion binding
GO:0005102	0.324	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0048518	0.942	positive regulation of biological process
GO:0009987	0.937	cellular process
GO:0006810	0.928	transport
GO:0006811	0.896	monoatomic ion transport
GO:0006826	0.886	iron ion transport
GO:0048519	0.878	negative regulation of biological process
GO:0048522	0.862	positive regulation of cellular process
GO:0019222	0.826	regulation of metabolic process
GO:0060255	0.802	regulation of macromolecule metabolic process
GO:0080090	0.790	regulation of primary metabolic process
GO:0051171	0.781	regulation of nitrogen compound metabolic process
GO:0051247	0.769	positive regulation of protein metabolic process
GO:0048523	0.762	negative regulation of cellular process
GO:0050896	0.719	response to stimulus
GO:0030155	0.715	regulation of cell adhesion
GO:0010468	0.657	regulation of gene expression
GO:0051128	0.589	regulation of cellular component organization
GO:0010810	0.576	regulation of cell-substrate adhesion
GO:0010628	0.568	positive regulation of gene expression
GO:0007162	0.518	negative regulation of cell adhesion
GO:1903317	0.497	regulation of protein maturation
GO:1903053	0.475	regulation of extracellular matrix organization
GO:0030162	0.465	regulation of proteolysis
GO:1900024	0.458	regulation of substrate adhesion-dependent cell spreading
GO:0010812	0.444	negative regulation of cell-substrate adhesion
GO:0008152	0.423	metabolic process
GO:0071704	0.389	organic substance metabolic process
GO:0070613	0.367	regulation of protein processing
GO:0044419	0.362	biological process involved in interspecies interaction between organisms
GO:0044238	0.315	primary metabolic process
GO:0006807	0.306	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005615	1.000	extracellular space
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0070013	0.999	intracellular organelle lumen
GO:0031982	0.997	vesicle
GO:0005886	0.996	plasma membrane
GO:1903561	0.986	extracellular vesicle
GO:0070062	0.984	extracellular exosome
GO:0009986	0.974	cell surface
GO:0005783	0.893	endoplasmic reticulum
GO:0097708	0.823	intracellular vesicle
GO:0031410	0.814	cytoplasmic vesicle
GO:0005788	0.812	endoplasmic reticulum lumen
GO:0005634	0.704	nucleus
GO:0032991	0.665	protein-containing complex
GO:0030141	0.566	secretory granule
GO:0031981	0.527	nuclear lumen
GO:0005768	0.425	endosome
GO:0031090	0.380	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]