StarFunc result for job id P08588

User Input

>input (477 residues)
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08588	1.000	1.000	8.532E-58	477	1.000	1.000	P08588.pdb.gz	ADRB1_HUMAN Beta-1 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB1 PE=1 SV=3
2	AFDB:P07700	0.642	0.635	7.046E-36	483	0.564	0.557	P07700.pdb.gz	ADRB1_MELGA Beta-1 adrenergic receptor OS=Meleagris gallopavo OX=9103 GN=ADRB1 PE=1 SV=1
3	AFDB:P10608	0.625	0.711	2.395E-32	418	0.438	0.500	P10608.pdb.gz	ADRB2_RAT Beta-2 adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adrb2 PE=1 SV=1
4	AFDB:P07550	0.631	0.728	1.809E-31	413	0.449	0.518	P07550.pdb.gz	ADRB2_HUMAN Beta-2 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB2 PE=1 SV=3
5	AFDB:B3DHM6	0.631	0.768	3.450E-31	390	0.491	0.600	B3DHM6.pdb.gz	B3DHM6_DANRE Adrenergic, beta-1-, receptor OS=Danio rerio OX=7955 GN=zgc:194728 PE=2 SV=1
6	AFDB:P13945	0.638	0.741	2.013E-30	408	0.463	0.542	P13945.pdb.gz	ADRB3_HUMAN Beta-3 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB3 PE=1 SV=3
7	AFDB:Q8UUY8	0.610	0.710	1.336E-29	409	0.434	0.506	Q8UUY8.pdb.gz	ADRB2_ONCMY Beta-2 adrenergic receptor OS=Oncorhynchus mykiss OX=8022 GN=adrb2 PE=2 SV=1
8	AFDB:E7EYN4	0.637	0.748	4.458E-29	405	0.403	0.474	E7EYN4.pdb.gz
9	AFDB:P25962	0.616	0.732	9.263E-29	400	0.423	0.505	P25962.pdb.gz	ADRB3_MOUSE Beta-3 adrenergic receptor OS=Mus musculus OX=10090 GN=Adrb3 PE=2 SV=2
10	AFDB:A0A2R8QNL3	0.636	0.739	1.487E-28	409	0.413	0.482	A0A2R8QNL3.pdb.gz
11	PDB:6iblA	0.559	0.667	9.536E-28	397	0.472	0.567	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
12	PDB:5d5aA	0.576	0.620	7.507E-25	442	0.405	0.437	5d5aA.pdb.gz	In meso in situ serial X-ray crystallography of soluble and membrane proteins at cryogenic temperatures.
13	PDB:4ldeA	0.545	0.572	4.381E-24	454	0.388	0.407	4ldeA.pdb.gz	Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.
14	PDB:7jvqR	0.542	0.880	5.404E-18	286	0.260	0.434	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
15	PDB:7xt8R	0.538	0.849	5.759E-17	294	0.252	0.408	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
16	PDB:7e32R	0.500	0.814	9.852E-16	285	0.237	0.396	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
17	PDB:7e2xR	0.516	0.858	4.840E-15	278	0.239	0.410	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
18	PDB:7jvrR	0.507	0.870	5.053E-15	269	0.214	0.379	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
19	PDB:7xtcR	0.517	0.870	5.275E-15	275	0.233	0.404	7xtcR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
20	PDB:7xtbR	0.520	0.864	1.546E-14	278	0.231	0.396	7xtbR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G1NEX5	0.0	536	457	0.583	0.608	G1NEX5_MELGA Adrenoceptor beta 1 OS=Meleagris gallopavo OX=9103 GN=ADRB1 PE=3 SV=3
2	P07700	0.0	535	483	0.581	0.573	ADRB1_MELGA Beta-1 adrenergic receptor OS=Meleagris gallopavo OX=9103 GN=ADRB1 PE=1 SV=1
3	P08588	0.0	952	477	1.000	1.000	ADRB1_HUMAN Beta-1 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB1 PE=1 SV=3
4	P18090	0.0	728	466	0.868	0.888	ADRB1_RAT Beta-1 adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adrb1 PE=1 SV=1
5	P34971	0.0	733	466	0.883	0.903	ADRB1_MOUSE Beta-1 adrenergic receptor OS=Mus musculus OX=10090 GN=Adrb1 PE=1 SV=2
6	B3DHM6	2.34e-159	458	390	0.497	0.608	B3DHM6_DANRE Adrenergic, beta-1-, receptor OS=Danio rerio OX=7955 GN=zgc:194728 PE=2 SV=1
7	P07550	3.91e-141	413	413	0.442	0.511	ADRB2_HUMAN Beta-2 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB2 PE=1 SV=3
8	P18762	4.02e-141	413	418	0.442	0.505	ADRB2_MOUSE Beta-2 adrenergic receptor OS=Mus musculus OX=10090 GN=Adrb2 PE=1 SV=2
9	P10608	2.64e-140	411	418	0.436	0.498	ADRB2_RAT Beta-2 adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adrb2 PE=1 SV=1
10	I7GPU6	1.10e-124	370	405	0.398	0.469	I7GPU6_DANRE Beta-2 adrenergic receptor OS=Danio rerio OX=7955 GN=adrb2a PE=2 SV=1
11	A0A060YAV5	1.46e-123	367	393	0.403	0.489	A0A060YAV5_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00036180001 PE=3 SV=1
12	A4QNV7	7.34e-120	358	409	0.398	0.465	A4QNV7_DANRE Beta-2 adrenergic receptor OS=Danio rerio OX=7955 GN=zgc:162188 PE=2 SV=1
13	A0A060XC03	9.83e-120	358	401	0.438	0.521	A0A060XC03_ONCMY Beta-2 adrenergic receptor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00012903001 PE=3 SV=1
14	Q8UUY8	4.54e-119	356	409	0.432	0.504	ADRB2_ONCMY Beta-2 adrenergic receptor OS=Oncorhynchus mykiss OX=8022 GN=adrb2 PE=2 SV=1
15	A0A060Y644	7.29e-116	348	408	0.405	0.473	A0A060Y644_ONCMY Adrenoceptor beta 2, surface b OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00054169001 PE=3 SV=1
16	P25962	5.00e-114	343	400	0.384	0.458	ADRB3_MOUSE Beta-3 adrenergic receptor OS=Mus musculus OX=10090 GN=Adrb3 PE=2 SV=2
17	P13945	5.79e-112	338	408	0.384	0.449	ADRB3_HUMAN Beta-3 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB3 PE=1 SV=3
18	P26255	4.66e-110	333	400	0.379	0.453	ADRB3_RAT Beta-3 adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adrb3 PE=2 SV=2
19	Q8BLD9	5.16e-69	229	478	0.302	0.301	DRD5_MOUSE D(1B) dopamine receptor OS=Mus musculus OX=10090 GN=Drd5 PE=2 SV=1
20	H0YPZ4	2.12e-68	227	453	0.279	0.294	H0YPZ4_TAEGU Dopamine receptor D1 OS=Taeniopygia guttata OX=59729 GN=DRD1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	9.9e-79	275.9	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	1.4	20.3	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	3.4e-13	61.1	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10323 7TM_GPCR_Srv	0.001	30.1	Serpentine type 7TM GPCR chemoreceptor Srv
5	PF10328 7TM_GPCR_Srx	0.00073	30.8	Serpentine type 7TM GPCR chemoreceptor Srx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358301

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.982	Disks large homolog 4
2	9606.ENSP00000345731	0.971	Disks large homolog 1
3	9606.ENSP00000360141	0.953	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
4	9606.ENSP00000409581	0.897	Beta-arrestin-1
5	9606.ENSP00000304604	0.893	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
6	9606.ENSP00000312999	0.859	Guanine nucleotide-binding protein G(i) subunit alpha-2
7	9606.ENSP00000358867	0.850	Guanine nucleotide-binding protein G(k) subunit alpha
8	9606.ENSP00000343027	0.840	Guanine nucleotide-binding protein G(i) subunit alpha-1
9	9606.ENSP00000305372	0.839	Beta-2 adrenergic receptor
10	9606.ENSP00000386444	0.830	S-arrestin
11	9606.ENSP00000419361	0.829	Adenylate cyclase type 5
12	9606.ENSP00000346151	0.825	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
13	9606.ENSP00000403701	0.819	Beta-arrestin-2
14	9606.ENSP00000376753	0.812	PDZ domain-containing protein GIPC1
15	9606.ENSP00000343782	0.811	Beta-3 adrenergic receptor
16	9606.ENSP00000478289	0.800	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
17	9606.ENSP00000312262	0.798	Beta-adrenergic receptor kinase 1
18	9606.ENSP00000365663	0.777	Natriuretic peptides A
19	9606.ENSP00000345502	0.771	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
20	9606.ENSP00000339740	0.743	Calcium/calmodulin-dependent protein kinase type II subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0004935	0.999	adrenergic receptor activity
GO:0005515	0.989	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.996	signal transduction
GO:0007186	0.992	G protein-coupled receptor signaling pathway
GO:0007188	0.859	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	0.846	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0031279	0.832	regulation of cyclase activity
GO:0051339	0.831	regulation of lyase activity
GO:0044093	0.765	positive regulation of molecular function
GO:0051239	0.757	regulation of multicellular organismal process
GO:0045761	0.695	regulation of adenylate cyclase activity
GO:0043085	0.684	positive regulation of catalytic activity
GO:0051349	0.626	positive regulation of lyase activity
GO:0032501	0.603	multicellular organismal process
GO:0048518	0.583	positive regulation of biological process
GO:0050795	0.535	regulation of behavior
GO:0042752	0.527	regulation of circadian rhythm
GO:0031281	0.520	positive regulation of cyclase activity
GO:0008152	0.470	metabolic process
GO:0065008	0.455	regulation of biological quality
GO:0044237	0.453	cellular metabolic process
GO:0019222	0.448	regulation of metabolic process
GO:0048522	0.441	positive regulation of cellular process
GO:0048519	0.440	negative regulation of biological process
GO:0032879	0.421	regulation of localization
GO:0042221	0.408	response to chemical
GO:0010646	0.403	regulation of cell communication
GO:0023051	0.399	regulation of signaling
GO:0048583	0.390	regulation of response to stimulus
GO:0048523	0.373	negative regulation of cellular process
GO:0071704	0.360	organic substance metabolic process
GO:0009966	0.314	regulation of signal transduction
GO:0051049	0.311	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.995	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0012505	0.979	endomembrane system
GO:0031982	0.922	vesicle
GO:0005634	0.747	nucleus
GO:0031410	0.612	cytoplasmic vesicle
GO:0005768	0.303	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]