StarFunc result for job id P08603

User Input

>input (1231 residues)
MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLG
NVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQL
LGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNS
GYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMG
YEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYP
ATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEH
FETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGY
ALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLG
YVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGY
ESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPG
FTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCN
PRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCS
ESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYR
CRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQ
ENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYT
CEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCF
EGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCAT
YYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSP
YEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQN
LYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFV
CKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1haqA	0.103	0.105	0.000	1213	0.984	0.998	1haqA.pdb.gz
2	AFDB:P06909	0.341	0.341	0.000	1234	0.616	0.614	P06909.pdb.gz	CFAH_MOUSE Complement factor H OS=Mus musculus OX=10090 GN=Cfh PE=1 SV=2
3	AFDB:P08603	1.000	1.000	0.000	1231	1.000	1.000	P08603.pdb.gz	CFAH_HUMAN Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4
4	AFDB:Q91YB6	0.328	0.327	0.000	1236	0.636	0.633	Q91YB6.pdb.gz	Q91YB6_RAT Complement inhibitory factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=2 SV=1
5	AFDB:E9Q8B5	0.365	0.496	1.257E-98	879	0.405	0.568	E9Q8B5.pdb.gz	E9Q8B5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
6	AFDB:E9Q8B6	0.339	0.490	2.076E-90	820	0.378	0.567	E9Q8B6.pdb.gz	E9Q8B6_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
7	AFDB:Q61408	0.324	0.481	2.404E-88	808	0.370	0.563	Q61408.pdb.gz	Q61408_MOUSE Complement factor H-related protein OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
8	AFDB:Q5XJW6	0.193	0.334	1.623E-76	689	0.366	0.653	Q5XJW6.pdb.gz	Q5XJW6_RAT Cfh protein OS=Rattus norvegicus OX=10116 GN=Cfh PE=1 SV=1
9	AFDB:P17927	0.149	0.098	2.161E-64	2039	0.265	0.160	P17927.pdb.gz	CR1_HUMAN Complement receptor type 1 OS=Homo sapiens OX=9606 GN=CR1 PE=1 SV=3
10	PDB:2q7zA	0.100	0.069	5.262E-53	1931	0.271	0.172	2q7zA.pdb.gz
11	AFDB:Q9BXR6	0.239	0.511	2.230E-52	569	0.240	0.520	Q9BXR6.pdb.gz	FHR5_HUMAN Complement factor H-related protein 5 OS=Homo sapiens OX=9606 GN=CFHR5 PE=1 SV=1
12	AFDB:Q07968	0.107	0.191	1.410E-49	669	0.173	0.318	Q07968.pdb.gz	F13B_MOUSE Coagulation factor XIII B chain OS=Mus musculus OX=10090 GN=F13b PE=1 SV=2
13	PDB:2gsxA	0.099	0.121	5.819E-47	951	0.197	0.254	2gsxA.pdb.gz
14	PDB:1c1zA	0.088	0.262	1.602E-16	326	0.063	0.236	1c1zA.pdb.gz
15	PDB:8a7eC	0.099	0.085	3.347E-10	1524	0.083	0.067	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:2xwbF	0.060	0.095	9.857E-8	714	0.039	0.067	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
17	PDB:4e0sB	0.072	0.093	1.311E-6	898	0.036	0.049	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
18	PDB:3t5oA	0.067	0.088	1.621E-6	871	0.036	0.051	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
19	PDB:8a7dQ	0.086	0.254	1.765E-6	273	0.036	0.161	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
20	PDB:7nycC	0.088	0.130	6.575E-6	809	0.041	0.062	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RUG5	0.0	930	878	0.366	0.514	B2RUG5_MOUSE EG214403 protein OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
2	E9PUM5	0.0	765	808	0.314	0.479	E9PUM5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
3	E9Q8B5	0.0	927	879	0.366	0.513	E9Q8B5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
4	E9Q8B6	0.0	850	820	0.344	0.517	E9Q8B6_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
5	G3V9R2	0.0	1662	1235	0.640	0.638	G3V9R2_RAT Complement factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=4 SV=1
6	P06909	0.0	1578	1234	0.617	0.615	CFAH_MOUSE Complement factor H OS=Mus musculus OX=10090 GN=Cfh PE=1 SV=2
7	P08603	0.0	2547	1231	1.000	1.000	CFAH_HUMAN Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4
8	Q0KHD2	0.0	850	820	0.344	0.517	Q0KHD2_MOUSE Complement factor H-related protein C OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
9	Q0KHD3	0.0	926	879	0.366	0.513	Q0KHD3_MOUSE Complement factor H-related protein C OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
10	Q5XJW6	0.0	676	689	0.288	0.515	Q5XJW6_RAT Cfh protein OS=Rattus norvegicus OX=10116 GN=Cfh PE=1 SV=1
11	Q61408	0.0	756	808	0.309	0.470	Q61408_MOUSE Complement factor H-related protein OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
12	Q91YB6	0.0	1643	1236	0.635	0.633	Q91YB6_RAT Complement inhibitory factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=2 SV=1
13	Q8R0I8	7.52e-145	449	509	0.195	0.472	Q8R0I8_MOUSE BC026782 protein OS=Mus musculus OX=10090 GN=Cfhr2 PE=2 SV=1
14	Q9BXR6	5.39e-144	449	569	0.183	0.395	FHR5_HUMAN Complement factor H-related protein 5 OS=Homo sapiens OX=9606 GN=CFHR5 PE=1 SV=1
15	Q03591	7.98e-132	408	330	0.174	0.648	FHR1_HUMAN Complement factor H-related protein 1 OS=Homo sapiens OX=9606 GN=CFHR1 PE=1 SV=2
16	Q61407	4.24e-124	392	452	0.171	0.465	Q61407_MOUSE Complement factor H-related protein (Fragment) OS=Mus musculus OX=10090 GN=Cfhr2 PE=2 SV=1
17	Q02985	1.00e-110	352	330	0.144	0.536	FHR3_HUMAN Complement factor H-related protein 3 OS=Homo sapiens OX=9606 GN=CFHR3 PE=1 SV=2
18	A0A668KLU9	3.58e-79	266	332	0.116	0.431	A0A668KLU9_MOUSE Complement factor H-related 2 OS=Mus musculus OX=10090 GN=Cfhr2 PE=1 SV=1
19	A0A1D5NSM8	1.59e-77	285	3615	0.278	0.095	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
20	Q4LDF6	2.49e-75	255	332	0.113	0.419	Q4LDF6_MOUSE Complement factor H-related 2 OS=Mus musculus OX=10090 GN=Cfhr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00084 Sushi	1.6e-156	520.1	Sushi repeat (SCR repeat)
2	PF09014 Sushi_2	87	14.5	Beta-2-glycoprotein-1 fifth domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356399

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245907	0.999	Complement C3
2	9606.ENSP00000255030	0.998	C-reactive protein
3	9606.ENSP00000378130	0.996	Complement factor I
4	9606.ENSP00000295927	0.995	Pentraxin-related protein PTX3
5	9606.ENSP00000436607	0.980	ADM
6	9606.ENSP00000314299	0.954	Complement factor H-related protein 1
7	9606.ENSP00000441691	0.938	Integrin alpha-M
8	9606.ENSP00000356395	0.925	Complement factor H-related protein 3
9	9606.ENSP00000416561	0.923	Complement factor B
10	9606.ENSP00000436682	0.916	Age-related maculopathy susceptibility 2
11	9606.ENSP00000261405	0.846	Von Willebrand factor
12	9606.ENSP00000262113	0.826	Myomesin-2
13	9606.ENSP00000356385	0.820	Complement factor H-related 2
14	9606.ENSP00000356391	0.813	Complement factor H-related protein 2
15	9606.ENSP00000299367	0.788	Complement C2
16	9606.ENSP00000313967	0.786	Complement C1q subcomponent subunit B
17	9606.ENSP00000252486	0.754	Apolipoprotein E
18	9606.ENSP00000360997	0.748	A disintegrin and metalloproteinase with thrombospondin motifs 13
19	9606.ENSP00000378058	0.741	EGF-containing fibulin-like extracellular matrix protein 1
20	9606.ENSP00000415941	0.736	Complement C4-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008201	1.000	heparin binding
GO:0042802	0.983	identical protein binding
GO:0043394	0.829	proteoglycan binding
GO:0043395	0.771	heparan sulfate proteoglycan binding
GO:0001848	0.559	complement binding
GO:0001846	0.401	opsonin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050896	0.996	response to stimulus
GO:0048518	0.989	positive regulation of biological process
GO:0048583	0.982	regulation of response to stimulus
GO:0006955	0.975	immune response
GO:0048584	0.967	positive regulation of response to stimulus
GO:0002682	0.966	regulation of immune system process
GO:0050794	0.965	regulation of cellular process
GO:0006956	0.960	complement activation
GO:0009987	0.954	cellular process
GO:0002697	0.935	regulation of immune effector process
GO:0006950	0.931	response to stress
GO:0030449	0.927	regulation of complement activation
GO:0071704	0.724	organic substance metabolic process
GO:0044238	0.686	primary metabolic process
GO:0009605	0.666	response to external stimulus
GO:0006807	0.643	nitrogen compound metabolic process
GO:0043170	0.621	macromolecule metabolic process
GO:1901564	0.472	organonitrogen compound metabolic process
GO:0051716	0.459	cellular response to stimulus
GO:0051707	0.456	response to other organism
GO:0032101	0.422	regulation of response to external stimulus
GO:0080134	0.409	regulation of response to stress
GO:0006952	0.403	defense response
GO:0032501	0.349	multicellular organismal process
GO:0019538	0.331	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.971	cell periphery
GO:0043227	0.963	membrane-bounded organelle
GO:0005622	0.947	intracellular anatomical structure
GO:0012505	0.946	endomembrane system
GO:0043231	0.941	intracellular membrane-bounded organelle
GO:0016020	0.927	membrane
GO:0031982	0.861	vesicle
GO:0005886	0.852	plasma membrane
GO:0032991	0.763	protein-containing complex
GO:0005737	0.744	cytoplasm
GO:1903561	0.726	extracellular vesicle
GO:0070062	0.701	extracellular exosome
GO:0072562	0.637	blood microparticle
GO:0070013	0.378	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]