StarFunc result for job id P08620

User Input

>input (206 residues)
MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08620	1.000	1.000	1.790E-36	206	1.000	1.000	P08620.pdb.gz	FGF4_HUMAN Fibroblast growth factor 4 OS=Homo sapiens OX=9606 GN=FGF4 PE=1 SV=1
2	AFDB:P11403	0.628	0.640	7.543E-28	202	0.733	0.748	P11403.pdb.gz	FGF4_MOUSE Fibroblast growth factor 4 OS=Mus musculus OX=10090 GN=Fgf4 PE=2 SV=2
3	AFDB:Q9DFC9	0.646	0.697	2.728E-24	191	0.573	0.618	Q9DFC9.pdb.gz	Q9DFC9_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fc89b01 PE=2 SV=1
4	AFDB:P48805	0.626	0.690	2.523E-23	187	0.539	0.594	P48805.pdb.gz	FGF4A_XENLA Fibroblast growth factor 4A OS=Xenopus laevis OX=8355 GN=fgf4-a PE=2 SV=1
5	AFDB:P10767	0.624	0.618	1.835E-21	208	0.495	0.490	P10767.pdb.gz	FGF6_HUMAN Fibroblast growth factor 6 OS=Homo sapiens OX=9606 GN=FGF6 PE=1 SV=4
6	AFDB:P12034	0.605	0.467	5.506E-17	268	0.345	0.265	P12034.pdb.gz	FGF5_HUMAN Fibroblast growth factor 5 OS=Homo sapiens OX=9606 GN=FGF5 PE=1 SV=4
7	AFDB:P48807	0.602	0.468	2.804E-16	266	0.379	0.293	P48807.pdb.gz	FGF5_RAT Fibroblast growth factor 5 OS=Rattus norvegicus OX=10116 GN=Fgf5 PE=2 SV=1
8	AFDB:P09038	0.596	0.428	7.053E-16	288	0.316	0.226	P09038.pdb.gz	FGF2_HUMAN Fibroblast growth factor 2 OS=Homo sapiens OX=9606 GN=FGF2 PE=1 SV=3
9	AFDB:A0A060Y7E5	0.593	0.784	8.762E-16	155	0.252	0.335	A0A060Y7E5.pdb.gz	A0A060Y7E5_ONCMY Fibroblast growth factor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000746001 PE=3 SV=1
10	AFDB:P12226	0.601	0.793	1.508E-15	155	0.267	0.355	P12226.pdb.gz	FGF2_XENLA Fibroblast growth factor 2 OS=Xenopus laevis OX=8355 GN=fgf2 PE=2 SV=2
11	PDB:3f1rA	0.583	0.762	8.938E-13	157	0.282	0.369	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
12	PDB:4jq0A	0.573	0.827	2.248E-12	141	0.248	0.362	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
13	PDB:1ry7A	0.589	0.792	4.211E-11	151	0.238	0.325	1ry7A.pdb.gz
14	PDB:6b0tA	0.499	0.224	6.284E-5	487	0.078	0.033	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:1t9fA	0.505	0.578	2.311E-4	178	0.087	0.101	1t9fA.pdb.gz
16	PDB:4qd2B	0.506	0.699	4.432E-4	143	0.058	0.084	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:3malA	0.474	0.533	5.813E-4	181	0.092	0.105	3malA.pdb.gz
18	PDB:7a5px	0.388	0.591	1.115E-3	125	0.063	0.104	7a5px.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
19	PDB:2d43A	0.481	0.220	2.138E-3	482	0.087	0.037	2d43A.pdb.gz	The family 42 carbohydrate-binding module of family 54 alpha-L-arabinofuranosidase specifically binds the arabinofuranose side chain of hemicellulose
20	PDB:4qd2C	0.515	0.379	2.257E-3	286	0.073	0.052	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08620	1.56e-150	417	206	1.000	1.000	FGF4_HUMAN Fibroblast growth factor 4 OS=Homo sapiens OX=9606 GN=FGF4 PE=1 SV=1
2	P11403	7.13e-102	294	202	0.801	0.817	FGF4_MOUSE Fibroblast growth factor 4 OS=Mus musculus OX=10090 GN=Fgf4 PE=2 SV=2
3	P48805	1.55e-77	232	187	0.539	0.594	FGF4A_XENLA Fibroblast growth factor 4A OS=Xenopus laevis OX=8355 GN=fgf4-a PE=2 SV=1
4	Q9DFC9	4.02e-75	226	191	0.573	0.618	Q9DFC9_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fc89b01 PE=2 SV=1
5	P10767	6.71e-65	201	208	0.529	0.524	FGF6_HUMAN Fibroblast growth factor 6 OS=Homo sapiens OX=9606 GN=FGF6 PE=1 SV=4
6	Q8R5L5	1.55e-64	200	208	0.529	0.524	Q8R5L5_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf6 PE=2 SV=1
7	P21658	2.13e-64	199	208	0.529	0.524	FGF6_MOUSE Fibroblast growth factor 6 OS=Mus musculus OX=10090 GN=Fgf6 PE=2 SV=2
8	P12034	5.61e-32	118	268	0.306	0.235	FGF5_HUMAN Fibroblast growth factor 5 OS=Homo sapiens OX=9606 GN=FGF5 PE=1 SV=4
9	P15656	6.35e-32	118	264	0.306	0.239	FGF5_MOUSE Fibroblast growth factor 5 OS=Mus musculus OX=10090 GN=Fgf5 PE=2 SV=1
10	P48807	6.36e-32	118	266	0.306	0.237	FGF5_RAT Fibroblast growth factor 5 OS=Rattus norvegicus OX=10116 GN=Fgf5 PE=2 SV=1
11	Q5TLE2	7.39e-31	114	225	0.296	0.271	Q5TLE2_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf5 PE=2 SV=1
12	Q9NP95	7.20e-28	106	211	0.330	0.322	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
13	P36364	8.02e-28	106	208	0.286	0.284	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
14	P54130	8.02e-28	106	208	0.286	0.284	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
15	P31371	8.74e-28	106	208	0.286	0.284	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
16	Q6PBT8	2.79e-27	103	147	0.286	0.401	FGF1_DANRE Putative fibroblast growth factor 1 OS=Danio rerio OX=7955 GN=fgf1 PE=2 SV=1
17	Q9ESL9	3.96e-27	104	211	0.301	0.294	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2
18	Q2LJ24	4.47e-27	104	208	0.301	0.298	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
19	Q9EST9	4.47e-27	104	212	0.301	0.292	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
20	Q38PL0	2.85e-26	102	208	0.277	0.274	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00167 FGF	2.2e-34	129.6	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000168712

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410294	0.997	Fibroblast growth factor receptor 2
2	9606.ENSP00000393312	0.992	Fibroblast growth factor receptor 1
3	9606.ENSP00000407586	0.943	GTPase HRas
4	9606.ENSP00000263025	0.940	Mitogen-activated protein kinase 3
5	9606.ENSP00000215832	0.919	Mitogen-activated protein kinase 1
6	9606.ENSP00000256078	0.918	GTPase KRas
7	9606.ENSP00000339824	0.918	Fibroblast growth factor receptor 3
8	9606.ENSP00000358548	0.918	GTPase NRas
9	9606.ENSP00000262648	0.904	Anosmin-1
10	9606.ENSP00000292408	0.896	Fibroblast growth factor receptor 4
11	9606.ENSP00000263923	0.829	Vascular endothelial growth factor receptor 2
12	9606.ENSP00000265171	0.809	Pro-epidermal growth factor
13	9606.ENSP00000259915	0.794	POU domain, class 5, transcription factor 1
14	9606.ENSP00000257290	0.787	Platelet-derived growth factor receptor alpha
15	9606.ENSP00000282397	0.787	Vascular endothelial growth factor receptor 1
16	9606.ENSP00000323588	0.782	Transcription factor SOX-2
17	9606.ENSP00000261799	0.771	Platelet-derived growth factor receptor beta
18	9606.ENSP00000288135	0.766	Mast/stem cell growth factor receptor Kit
19	9606.ENSP00000369375	0.762	Angiopoietin-1 receptor
20	9606.ENSP00000275493	0.761	Epidermal growth factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity
GO:0070851	0.390	growth factor receptor binding
GO:0005104	0.301	fibroblast growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048518	0.997	positive regulation of biological process
GO:0051716	0.996	cellular response to stimulus
GO:0032502	0.995	developmental process
GO:0048856	0.994	anatomical structure development
GO:0032501	0.993	multicellular organismal process
GO:0048522	0.990	positive regulation of cellular process
GO:0007165	0.990	signal transduction
GO:0042127	0.985	regulation of cell population proliferation
GO:0070848	0.981	response to growth factor
GO:0007275	0.975	multicellular organism development
GO:0071774	0.966	response to fibroblast growth factor
GO:0008543	0.961	fibroblast growth factor receptor signaling pathway
GO:0008284	0.957	positive regulation of cell population proliferation
GO:0048513	0.952	animal organ development
GO:0023051	0.895	regulation of signaling
GO:0048731	0.895	system development
GO:0009966	0.889	regulation of signal transduction
GO:0009888	0.859	tissue development
GO:0019222	0.853	regulation of metabolic process
GO:0048584	0.827	positive regulation of response to stimulus
GO:0023056	0.814	positive regulation of signaling
GO:0040012	0.813	regulation of locomotion
GO:0060255	0.794	regulation of macromolecule metabolic process
GO:0009967	0.784	positive regulation of signal transduction
GO:0080090	0.766	regulation of primary metabolic process
GO:0031323	0.762	regulation of cellular metabolic process
GO:0051171	0.746	regulation of nitrogen compound metabolic process
GO:0009893	0.734	positive regulation of metabolic process
GO:0048519	0.633	negative regulation of biological process
GO:0010604	0.622	positive regulation of macromolecule metabolic process
GO:1902531	0.609	regulation of intracellular signal transduction
GO:0051239	0.592	regulation of multicellular organismal process
GO:0051173	0.591	positive regulation of nitrogen compound metabolic process
GO:0031325	0.585	positive regulation of cellular metabolic process
GO:0043410	0.561	positive regulation of MAPK cascade
GO:0010468	0.558	regulation of gene expression
GO:0001501	0.528	skeletal system development
GO:0048523	0.506	negative regulation of cellular process
GO:0030334	0.488	regulation of cell migration
GO:0048869	0.445	cellular developmental process
GO:0030154	0.443	cell differentiation
GO:0031326	0.412	regulation of cellular biosynthetic process
GO:0009653	0.409	anatomical structure morphogenesis
GO:0010556	0.407	regulation of macromolecule biosynthetic process
GO:0050793	0.383	regulation of developmental process
GO:0061448	0.374	connective tissue development
GO:0051246	0.374	regulation of protein metabolic process
GO:0019219	0.357	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.340	regulation of DNA-templated transcription
GO:0010557	0.327	positive regulation of macromolecule biosynthetic process
GO:0031328	0.327	positive regulation of cellular biosynthetic process
GO:0045935	0.323	positive regulation of nucleobase-containing compound metabolic process
GO:0051247	0.310	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0016020	0.619	membrane
GO:0071944	0.389	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]