StarFunc result for job id P08621

User Input

>input (437 residues)
MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRA
ETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLR
REFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVER
GRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERE
RRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERAR
RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRS
ERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGG
DGYLAPENGYLMEAAPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RZ74	0.494	0.480	1.493E-64	451	0.977	0.947	B2RZ74.pdb.gz	B2RZ74_RAT Small nuclear ribonucleoprotein U1 subunit 70 OS=Rattus norvegicus OX=10116 GN=Snrnp70 PE=1 SV=1
2	AFDB:Q6DRE8	0.509	0.451	2.494E-42	495	0.677	0.598	Q6DRE8.pdb.gz	Q6DRE8_DANRE U1 small nuclear ribonucleoprotein 70 kDa OS=Danio rerio OX=7955 GN=snrp70 PE=1 SV=1
3	AFDB:Q1ED03	0.351	0.445	1.742E-35	339	0.398	0.513	Q1ED03.pdb.gz
4	PDB:6qx91K	0.338	0.721	7.844E-34	201	0.458	0.995	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
5	AFDB:P17133	0.402	0.393	3.059E-33	448	0.446	0.435	P17133.pdb.gz	RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster OX=7227 GN=snRNP-U1-70K PE=1 SV=2
6	AFDB:Q42404	0.359	0.367	1.217E-28	427	0.346	0.354	Q42404.pdb.gz	RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana OX=3702 GN=RNU1 PE=1 SV=1
7	AFDB:O13829	0.334	0.549	1.190E-24	261	0.227	0.379	O13829.pdb.gz	RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=usp101 PE=1 SV=1
8	AFDB:Q00916	0.306	0.438	3.865E-18	300	0.174	0.253	Q00916.pdb.gz	RU17_YEAST U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNP1 PE=1 SV=1
9	AFDB:Q8VY74	0.272	0.354	1.198E-14	333	0.188	0.246	Q8VY74.pdb.gz	U1135_ARATH U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Arabidopsis thaliana OX=3702 GN=SNRNP35 PE=1 SV=1
10	AFDB:A0A024RBU2	0.248	0.433	1.049E-13	246	0.144	0.256	A0A024RBU2.pdb.gz
11	PDB:6g90B	0.299	0.654	2.508E-13	193	0.133	0.301	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
12	AFDB:Q9XYZ6	0.191	0.130	4.849E-13	653	0.233	0.156	Q9XYZ6.pdb.gz	Q9XYZ6_DROME Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster OX=7227 GN=UKL PE=2 SV=1
13	PDB:6n7pA	0.263	0.586	1.229E-11	186	0.121	0.285	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
14	PDB:5yzg1	0.171	0.305	3.354E-8	243	0.043	0.078	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:3lqvB	0.164	0.597	5.956E-8	115	0.046	0.174	3lqvB.pdb.gz	Branch Recognition by SF3b14
16	PDB:5oobB	0.183	0.505	6.349E-8	152	0.069	0.197	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
17	PDB:7dvqY	0.177	0.530	9.923E-8	140	0.078	0.243	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:6y53o	0.175	0.467	1.365E-7	160	0.048	0.131	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
19	PDB:5gm6V	0.174	0.575	2.134E-7	128	0.057	0.195	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:5xjcw	0.178	0.802	2.754E-7	91	0.057	0.275	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6G5W4	0.0	815	436	0.977	0.979	A0A8I6G5W4_RAT U1 small nuclear ribonucleoprotein 70 kDa OS=Rattus norvegicus OX=10116 GN=Snrnp70 PE=1 SV=1
2	B2RZ74	0.0	805	451	0.977	0.947	B2RZ74_RAT Small nuclear ribonucleoprotein U1 subunit 70 OS=Rattus norvegicus OX=10116 GN=Snrnp70 PE=1 SV=1
3	P08621	0.0	842	437	1.000	1.000	RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2
4	Q62376	0.0	806	448	0.977	0.953	RU17_MOUSE U1 small nuclear ribonucleoprotein 70 kDa OS=Mus musculus OX=10090 GN=Snrnp70 PE=1 SV=2
5	Q6DRE8	2.98e-118	356	495	0.465	0.410	Q6DRE8_DANRE U1 small nuclear ribonucleoprotein 70 kDa OS=Danio rerio OX=7955 GN=snrp70 PE=1 SV=1
6	D3Z8H0	1.80e-116	339	166	0.366	0.964	D3Z8H0_RAT Small nuclear ribonucleoprotein U1 subunit 70 OS=Rattus norvegicus OX=10116 GN=Snrnp70 PE=4 SV=1
7	E7EY23	7.99e-90	271	162	0.327	0.883	E7EY23_DANRE U1 small nuclear ribonucleoprotein 70 kDa OS=Danio rerio OX=7955 GN=snrp70 PE=1 SV=2
8	P17133	2.54e-79	254	448	0.332	0.324	RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster OX=7227 GN=snRNP-U1-70K PE=1 SV=2
9	Q42404	2.02e-74	241	427	0.314	0.321	RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana OX=3702 GN=RNU1 PE=1 SV=1
10	A0A8I5ZV69	8.76e-57	187	180	0.201	0.489	A0A8I5ZV69_RAT Small nuclear ribonucleoprotein U1 subunit 70 OS=Rattus norvegicus OX=10116 GN=Snrnp70 PE=1 SV=1
11	O13829	2.97e-42	152	261	0.206	0.345	RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=usp101 PE=1 SV=1
12	Q8VY74	2.08e-21	96.7	333	0.190	0.249	U1135_ARATH U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Arabidopsis thaliana OX=3702 GN=SNRNP35 PE=1 SV=1
13	Q16560	3.97e-20	91.3	246	0.192	0.341	U1SBP_HUMAN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP35 PE=1 SV=1
14	Q00916	4.93e-18	86.3	300	0.142	0.207	RU17_YEAST U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNP1 PE=1 SV=1
15	Q9XYZ6	1.03e-13	75.5	653	0.151	0.101	Q9XYZ6_DROME Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster OX=7227 GN=UKL PE=2 SV=1
16	P33240	5.53e-11	67.0	577	0.059	0.045	CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
17	E7EWR4	6.08e-11	66.6	597	0.059	0.044	E7EWR4_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
18	B4F7F1	6.76e-11	66.6	575	0.059	0.045	B4F7F1_RAT Cstf2 protein OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
19	A0A8I5ZY65	7.19e-11	66.2	549	0.059	0.047	A0A8I5ZY65_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
20	A0A0G2JWP1	7.26e-11	66.6	569	0.059	0.046	A0A0G2JWP1_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	2.9e-14	64.0	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF13893 RRM_5	2.3e+02	12.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	1.4e+02	14.0	RNA recognition motif
4	PF12220 U1snRNP70_N	1.4e-22	91.5	U1 small nuclear ribonucleoprotein of 70kDa MW N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010367740.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010360199.1	0.999	Small nuclear ribonucleoprotein G isoform X1
2	61622.XP_010375768.1	0.999	Small nuclear ribonucleoprotein Sm D2
3	61622.XP_010353183.1	0.998	Small nuclear ribonucleoprotein Sm D1
4	61622.XP_010351686.1	0.995	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 59 ESTs, 11 Proteins, and 86% coverage of the annotated genomic feature by RNAseq alignments
5	61622.XP_010374612.1	0.995	Small nuclear ribonucleoprotein Sm D3
6	61622.XP_010377314.1	0.995	Small nuclear ribonucleoprotein polypeptides B and B1
7	61622.XP_010379130.1	0.995	U1 small nuclear ribonucleoprotein A
8	61622.XP_010379681.1	0.995	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing. May indirectly play a role in hair development.
9	61622.XP_010387599.1	0.995	pre-mRNA-processing factor 39 isoform X1
10	61622.XP_010387936.1	0.995	Small nuclear ribonucleoprotein D3 polypeptide
11	61622.XP_010371222.1	0.994	Serine and arginine rich splicing factor 1
12	61622.XP_010379765.1	0.993	U2 small nuclear ribonucleoprotein B''
13	61622.XP_010379981.1	0.993	Small nuclear ribonucleoprotein polypeptide A
14	61622.XP_010373163.1	0.991	Splicing factor 3a subunit 2
15	61622.XP_010355474.1	0.990	Small nuclear ribonucleoprotein F-like
16	61622.XP_010382200.1	0.990	Small nuclear ribonucleoprotein F
17	61622.XP_010350986.1	0.989	Splicing factor 3A subunit 3
18	61622.XP_010379472.1	0.989	Nuclear cap-binding protein subunit 2 isoform X1
19	61622.XP_010354132.1	0.988	RNA-binding protein 25
20	61622.XP_010383686.1	0.988	pre-mRNA processing factor 40 homolog B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990446	1.000	U1 snRNP binding
GO:0003723	1.000	RNA binding
GO:0005515	0.997	protein binding
GO:0017069	0.993	snRNA binding
GO:0003729	0.711	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.959	response to stimulus
GO:0050789	0.953	regulation of biological process
GO:0071559	0.951	response to transforming growth factor beta
GO:0071704	0.932	organic substance metabolic process
GO:0044238	0.925	primary metabolic process
GO:0044237	0.921	cellular metabolic process
GO:0050794	0.920	regulation of cellular process
GO:0034097	0.912	response to cytokine
GO:0006807	0.907	nitrogen compound metabolic process
GO:0019222	0.906	regulation of metabolic process
GO:0060255	0.886	regulation of macromolecule metabolic process
GO:0043170	0.885	macromolecule metabolic process
GO:0034612	0.883	response to tumor necrosis factor
GO:0043484	0.882	regulation of RNA splicing
GO:0010467	0.855	gene expression
GO:0034641	0.855	cellular nitrogen compound metabolic process
GO:0090304	0.853	nucleic acid metabolic process
GO:0051716	0.834	cellular response to stimulus
GO:0016070	0.802	RNA metabolic process
GO:0071560	0.787	cellular response to transforming growth factor beta stimulus
GO:0048518	0.779	positive regulation of biological process
GO:0070887	0.764	cellular response to chemical stimulus
GO:1901700	0.762	response to oxygen-containing compound
GO:0033993	0.747	response to lipid
GO:0071396	0.743	cellular response to lipid
GO:1901701	0.741	cellular response to oxygen-containing compound
GO:0071356	0.727	cellular response to tumor necrosis factor
GO:0006396	0.697	RNA processing
GO:1903311	0.682	regulation of mRNA metabolic process
GO:0032526	0.620	response to retinoic acid
GO:0048522	0.618	positive regulation of cellular process
GO:0071300	0.595	cellular response to retinoic acid
GO:0008380	0.558	RNA splicing
GO:0006397	0.536	mRNA processing
GO:0000398	0.530	mRNA splicing, via spliceosome
GO:0048519	0.448	negative regulation of biological process
GO:0010604	0.415	positive regulation of macromolecule metabolic process
GO:0051173	0.396	positive regulation of nitrogen compound metabolic process
GO:0031325	0.396	positive regulation of cellular metabolic process
GO:0050684	0.343	regulation of mRNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:1990904	0.998	ribonucleoprotein complex
GO:0140513	0.995	nuclear protein-containing complex
GO:0120114	0.989	Sm-like protein family complex
GO:0097525	0.983	spliceosomal snRNP complex
GO:0005685	0.962	U1 snRNP
GO:0005737	0.957	cytoplasm
GO:0005681	0.894	spliceosomal complex
GO:0016604	0.863	nuclear body
GO:0005829	0.635	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]