StarFunc result for job id P08631

User Input

>input (526 residues)
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KPD6	0.847	0.847	7.963E-94	526	0.998	0.998	J3KPD6.pdb.gz	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
2	AFDB:P08103	0.915	0.918	1.547E-91	524	0.897	0.901	P08103.pdb.gz	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
3	AFDB:P07948	0.907	0.931	1.844E-78	512	0.688	0.707	P07948.pdb.gz	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
4	AFDB:Q5ZMB9	0.840	0.897	3.426E-75	492	0.688	0.736	Q5ZMB9.pdb.gz	Q5ZMB9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=LYN PE=1 SV=1
5	AFDB:P06239	0.825	0.852	1.914E-74	509	0.639	0.660	P06239.pdb.gz	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
6	AFDB:Q66I04	0.837	0.863	1.932E-73	510	0.669	0.690	Q66I04.pdb.gz	Q66I04_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:92124 PE=2 SV=1
7	AFDB:P51451	0.838	0.872	5.182E-71	505	0.610	0.636	P51451.pdb.gz	BLK_HUMAN Tyrosine-protein kinase Blk OS=Homo sapiens OX=9606 GN=BLK PE=1 SV=3
8	AFDB:P16277	0.838	0.881	1.987E-70	499	0.618	0.651	P16277.pdb.gz	BLK_MOUSE Tyrosine-protein kinase Blk OS=Mus musculus OX=10090 GN=Blk PE=1 SV=4
9	AFDB:W5U6C9	0.794	0.833	7.693E-69	500	0.584	0.614	W5U6C9.pdb.gz	W5U6C9_ICTPU Tyrosine-protein kinase OS=Ictalurus punctatus OX=7998 GN=LCK PE=2 SV=1
10	AFDB:A1A5H8	0.837	0.806	8.118E-69	546	0.593	0.571	A1A5H8.pdb.gz	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
11	PDB:2h8hA	0.809	0.951	1.982E-62	445	0.530	0.627	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.486	0.571	1.050E-38	441	0.327	0.390	1k9aB.pdb.gz
13	PDB:4fl2A	0.471	0.447	1.756E-29	555	0.264	0.250	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.465	0.445	1.240E-26	551	0.234	0.223	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:7mfdA	0.434	0.547	1.159E-16	410	0.188	0.241	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
16	PDB:6s73A	0.428	0.808	1.688E-16	269	0.135	0.264	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:8dksA	0.387	0.687	2.230E-15	283	0.135	0.251	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
18	PDB:4btfA	0.422	0.529	4.995E-15	413	0.133	0.169	4btfA.pdb.gz
19	PDB:4krcA	0.421	0.715	1.005E-14	297	0.129	0.229	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
20	PDB:6lk5A	0.423	0.800	2.375E-14	265	0.125	0.249	6lk5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1A5H8	637	546	0.601	0.579	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
2	E1BIM8	602	688	0.532	0.407	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
3	F1LM93	627	541	0.565	0.549	YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus OX=10116 GN=Yes1 PE=1 SV=1
4	F1NQU9	619	534	0.563	0.554	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
5	F1RDG9	615	544	0.553	0.535	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
6	H0Y3C5	1094	525	0.996	0.998	H0Y3C5_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
7	J3KPD6	1101	526	0.998	0.998	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
8	J3QRU1	628	548	0.567	0.544	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
9	P00523	602	533	0.534	0.527	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
10	P05480	601	535	0.532	0.523	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
11	P06239	696	509	0.616	0.637	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
12	P06240	699	509	0.643	0.664	LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus OX=10090 GN=Lck PE=1 SV=4
13	P06241	627	537	0.572	0.561	FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3
14	P07947	628	543	0.567	0.549	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
15	P07948	754	512	0.692	0.711	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
16	P08103	985	524	0.897	0.901	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
17	P08631	1102	526	1.000	1.000	HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=5
18	P09324	629	541	0.565	0.549	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
19	P09769	593	529	0.553	0.550	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
20	P12931	600	536	0.530	0.521	SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.9	20.2	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	65	13.9	Haspin like kinase domain
3	PF00069 Pkinase	2.2e-42	156.8	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	4.5e-92	319.6	Protein tyrosine and serine/threonine kinase
5	PF00017 SH2	6.2e-22	88.8	SH2 domain
6	PF00018 SH3_1	1.6e-13	61.3	SH3 domain
7	PF07653 SH3_2	5.9e-06	37.3	Variant SH3 domain
8	PF14604 SH3_9	2.8e-05	35.3	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444986

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.988	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000387784	0.987	Son of sevenless homolog 1
3	9606.ENSP00000275493	0.985	Epidermal growth factor receptor
4	9606.ENSP00000244007	0.983	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
5	9606.ENSP00000380948	0.982	Integrin beta-2
6	9606.ENSP00000358165	0.979	High affinity immunoglobulin gamma Fc receptor I
7	9606.ENSP00000356946	0.977	Low affinity immunoglobulin gamma Fc region receptor III-A
8	9606.ENSP00000264657	0.976	Signal transducer and activator of transcription 3
9	9606.ENSP00000363117	0.971	Tyrosine-protein kinase Fgr
10	9606.ENSP00000271450	0.969	Low affinity immunoglobulin gamma Fc region receptor II-a
11	9606.ENSP00000312185	0.966	Engulfment and cell motility protein 1
12	9606.ENSP00000441691	0.964	Integrin alpha-M
13	9606.ENSP00000409581	0.962	Beta-arrestin-1
14	9606.ENSP00000289153	0.956	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
15	9606.ENSP00000483570	0.954	Tyrosine-protein kinase BTK
16	9606.ENSP00000394049	0.953	Src-like-adapter
17	9606.ENSP00000482457	0.953	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
18	9606.ENSP00000391669	0.952	Breast cancer anti-estrogen resistance protein 1
19	9606.ENSP00000361423	0.951	Tyrosine-protein kinase ABL1
20	9606.ENSP00000233668	0.950	Docking protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0019899	0.858	enzyme binding
GO:0005102	0.844	signaling receptor binding
GO:0004715	0.740	non-membrane spanning protein tyrosine kinase activity
GO:0051219	0.724	phosphoprotein binding
GO:0019900	0.658	kinase binding
GO:0019901	0.624	protein kinase binding
GO:0001784	0.379	phosphotyrosine residue binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0009987	0.983	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0051716	0.973	cellular response to stimulus
GO:0023052	0.968	signaling
GO:0007154	0.968	cell communication
GO:0048583	0.956	regulation of response to stimulus
GO:0006468	0.951	protein phosphorylation
GO:0048522	0.920	positive regulation of cellular process
GO:0007165	0.894	signal transduction
GO:0002429	0.851	immune response-activating cell surface receptor signaling pathway
GO:0042221	0.816	response to chemical
GO:0051179	0.760	localization
GO:0009605	0.760	response to external stimulus
GO:0016192	0.737	vesicle-mediated transport
GO:0019222	0.627	regulation of metabolic process
GO:0006950	0.603	response to stress
GO:0032501	0.579	multicellular organismal process
GO:0032502	0.530	developmental process
GO:0060255	0.454	regulation of macromolecule metabolic process
GO:0070887	0.435	cellular response to chemical stimulus
GO:0048519	0.434	negative regulation of biological process
GO:0006909	0.422	phagocytosis
GO:0065009	0.421	regulation of molecular function
GO:0051239	0.420	regulation of multicellular organismal process
GO:0080090	0.408	regulation of primary metabolic process
GO:0031323	0.408	regulation of cellular metabolic process
GO:0032101	0.405	regulation of response to external stimulus
GO:0051171	0.404	regulation of nitrogen compound metabolic process
GO:0009893	0.402	positive regulation of metabolic process
GO:0048856	0.395	anatomical structure development
GO:0010604	0.394	positive regulation of macromolecule metabolic process
GO:0048523	0.389	negative regulation of cellular process
GO:0023051	0.353	regulation of signaling
GO:0010646	0.353	regulation of cell communication
GO:0010468	0.349	regulation of gene expression
GO:0009607	0.348	response to biotic stimulus
GO:0009966	0.338	regulation of signal transduction
GO:0071840	0.331	cellular component organization or biogenesis
GO:0042325	0.323	regulation of phosphorylation
GO:0044419	0.310	biological process involved in interspecies interaction between organisms
GO:0010033	0.306	response to organic substance
GO:0050790	0.303	regulation of catalytic activity
GO:0044093	0.303	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0005634	0.384	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.740	non-specific protein-tyrosine kinase.

[back to server]