StarFunc result for job id P08637

User Input

>input (254 residues)
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQW
FHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE
EDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKN
VSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDW
KDHKFKWRKDPQDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1W2PQB1	0.851	0.751	2.114E-45	290	0.961	0.841	A0A1W2PQB1.pdb.gz	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
2	AFDB:A0A0B4J1G0	0.679	0.692	3.856E-33	249	0.610	0.622	A0A0B4J1G0.pdb.gz	FCG3A_MOUSE Low affinity immunoglobulin gamma Fc region receptor III-A OS=Mus musculus OX=10090 GN=Fcgr4 PE=1 SV=1
3	AFDB:Q6XPU4	0.669	0.682	5.623E-33	249	0.594	0.606	Q6XPU4.pdb.gz	FCG3A_RAT Low affinity immunoglobulin gamma Fc region receptor III-A OS=Rattus norvegicus OX=10116 GN=Fcgr3a PE=2 SV=1
4	AFDB:P27645	0.691	0.659	7.382E-29	267	0.480	0.457	P27645.pdb.gz	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
5	AFDB:P08508	0.682	0.664	7.487E-28	261	0.465	0.452	P08508.pdb.gz	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
6	AFDB:P12318	0.648	0.527	4.258E-26	317	0.390	0.312	P12318.pdb.gz	FCG2A_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4
7	AFDB:P08101	0.660	0.512	1.123E-25	330	0.394	0.303	P08101.pdb.gz	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
8	AFDB:P31995	0.658	0.523	2.520E-25	323	0.382	0.300	P31995.pdb.gz	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
9	AFDB:P31994	0.661	0.545	6.647E-25	310	0.374	0.306	P31994.pdb.gz	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
10	AFDB:Q63203	0.642	0.575	6.647E-25	285	0.362	0.323	Q63203.pdb.gz	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1
11	PDB:6dldD	0.237	0.226	1.556E-8	269	0.114	0.108	6dldD.pdb.gz
12	PDB:6dlfA	0.232	0.245	1.098E-6	236	0.114	0.123	6dlfA.pdb.gz
13	PDB:5oj2B	0.258	0.115	2.896E-6	692	0.087	0.032	5oj2B.pdb.gz
14	PDB:6dcvA	0.236	0.267	4.964E-6	220	0.126	0.145	6dcvA.pdb.gz
15	PDB:1cf8L	0.255	0.296	7.638E-6	215	0.130	0.153	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
16	PDB:3o11A	0.229	0.268	9.475E-6	212	0.126	0.151	3o11A.pdb.gz
17	PDB:1e07A	0.249	0.119	1.114E-5	642	0.138	0.055	1e07A.pdb.gz
18	PDB:5c6wJ	0.276	0.293	1.175E-5	238	0.118	0.126	5c6wJ.pdb.gz
19	PDB:1kcsL	0.212	0.246	1.309E-5	214	0.110	0.131	1kcsL.pdb.gz	Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.
20	PDB:4hixL	0.241	0.273	1.309E-5	219	0.114	0.132	4hixL.pdb.gz	Bapineuzumab captures the N-terminus of the Alzheimer's disease amyloid-beta peptide in a helical conformation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2PQB1	0.0	530	290	1.000	0.876	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
2	P08637	0.0	530	254	1.000	1.000	FCG3A_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-A OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=2
3	O75015	2.24e-170	471	233	0.894	0.974	FCG3B_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-B OS=Homo sapiens OX=9606 GN=FCGR3B PE=1 SV=2
4	A3RFZ7	2.36e-168	466	254	0.917	0.917	FCG3A_MACMU Low affinity immunoglobulin gamma Fc region receptor III-A OS=Macaca mulatta OX=9544 GN=FCGR3A PE=1 SV=1
5	A0A0B4J1G0	5.01e-113	326	249	0.614	0.627	FCG3A_MOUSE Low affinity immunoglobulin gamma Fc region receptor III-A OS=Mus musculus OX=10090 GN=Fcgr4 PE=1 SV=1
6	Q6XPU4	1.98e-97	287	249	0.594	0.606	FCG3A_RAT Low affinity immunoglobulin gamma Fc region receptor III-A OS=Rattus norvegicus OX=10116 GN=Fcgr3a PE=2 SV=1
7	P27645	3.27e-74	228	267	0.469	0.446	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
8	P08508	2.38e-70	218	261	0.445	0.433	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
9	P08101	1.27e-56	186	330	0.366	0.282	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
10	Q63203	4.18e-54	177	285	0.362	0.323	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1
11	Q92637	2.70e-53	175	280	0.370	0.336	FCGRB_HUMAN Putative high affinity immunoglobulin gamma Fc receptor IB OS=Homo sapiens OX=9606 GN=FCGR1BP PE=5 SV=1
12	P31994	6.41e-53	175	310	0.354	0.290	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
13	P31995	7.14e-53	176	323	0.354	0.279	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
14	P12318	1.08e-51	172	317	0.374	0.300	FCG2A_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4
15	P12314	5.84e-49	167	374	0.370	0.251	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
16	P12319	7.48e-48	160	257	0.370	0.366	FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha OS=Homo sapiens OX=9606 GN=FCER1A PE=1 SV=1
17	P26151	3.58e-45	158	404	0.358	0.225	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
18	P12371	3.46e-43	148	245	0.335	0.347	FCERA_RAT High affinity immunoglobulin epsilon receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Fcer1a PE=1 SV=1
19	A0A0B4J2J0	1.04e-39	142	353	0.335	0.241	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
20	P20489	5.65e-33	122	250	0.323	0.328	FCERA_MOUSE High affinity immunoglobulin epsilon receptor subunit alpha OS=Mus musculus OX=10090 GN=Fcer1a PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	0.0019	29.6	Immunoglobulin I-set domain
2	PF00047 ig	7e-08	43.9	Immunoglobulin domain
3	PF13895 Ig_2	1.3e-15	68.8	Immunoglobulin domain
4	PF13927 Ig_3	1.3e-11	56.2	Immunoglobulin domain
5	PF16680 Ig_4	1.8e-06	39.7	T-cell surface glycoprotein CD3 delta chain
6	PF16681 Ig_5	2.1	20.2	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
7	PF16706 Izumo-Ig	2.4e+02	13.1	Izumo-like Immunoglobulin domain
8	PF07686 V-set	0.037	25.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356946

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358490	0.994	T-cell surface antigen CD2
2	9606.ENSP00000354782	0.993	T-cell surface glycoprotein CD3 zeta chain
3	9606.ENSP00000289902	0.980	High affinity immunoglobulin epsilon receptor subunit gamma
4	9606.ENSP00000444986	0.977	Tyrosine-protein kinase HCK
5	9606.ENSP00000433642	0.972	Low affinity immunoglobulin gamma Fc region receptor III-B
6	9606.ENSP00000324890	0.968	T-cell-specific surface glycoprotein CD28
7	9606.ENSP00000375629	0.968	Leukocyte immunoglobulin-like receptor subfamily B member 2
8	9606.ENSP00000364907	0.963	Tyrosine-protein kinase SYK
9	9606.ENSP00000363117	0.959	Tyrosine-protein kinase Fgr
10	9606.ENSP00000011653	0.937	T-cell surface glycoprotein CD4
11	9606.ENSP00000428924	0.929	Tyrosine-protein kinase Lyn
12	9606.ENSP00000315997	0.928	Leukocyte immunoglobulin-like receptor subfamily B member 1
13	9606.ENSP00000362680	0.927	Proto-oncogene tyrosine-protein kinase Src
14	9606.ENSP00000411355	0.926	Receptor-type tyrosine-protein phosphatase C
15	9606.ENSP00000480132	0.926	Neural cell adhesion molecule 1
16	9606.ENSP00000346671	0.919	Tyrosine-protein kinase Fyn
17	9606.ENSP00000226279	0.918	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
18	9606.ENSP00000358165	0.908	High affinity immunoglobulin gamma Fc receptor I
19	9606.ENSP00000216181	0.906	Myosin-9
20	9606.ENSP00000263967	0.905	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140375	0.999	immune receptor activity
GO:0004888	0.999	transmembrane signaling receptor activity
GO:0042802	0.320	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0002376	0.995	immune system process
GO:0009987	0.992	cellular process
GO:0006955	0.988	immune response
GO:0002252	0.982	immune effector process
GO:0050789	0.978	regulation of biological process
GO:0006950	0.972	response to stress
GO:0006952	0.961	defense response
GO:0002443	0.937	leukocyte mediated immunity
GO:0002250	0.934	adaptive immune response
GO:0006954	0.921	inflammatory response
GO:0050794	0.875	regulation of cellular process
GO:0002449	0.868	lymphocyte mediated immunity
GO:0002460	0.834	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0001906	0.830	cell killing
GO:0048518	0.746	positive regulation of biological process
GO:0001909	0.739	leukocyte mediated cytotoxicity
GO:0051716	0.727	cellular response to stimulus
GO:0019724	0.726	B cell mediated immunity
GO:0002526	0.701	acute inflammatory response
GO:0016064	0.686	immunoglobulin mediated immune response
GO:0002444	0.685	myeloid leukocyte mediated immunity
GO:0002437	0.679	inflammatory response to antigenic stimulus
GO:0051239	0.657	regulation of multicellular organismal process
GO:0007154	0.627	cell communication
GO:0023052	0.614	signaling
GO:0032501	0.612	multicellular organismal process
GO:0007165	0.522	signal transduction
GO:0048522	0.503	positive regulation of cellular process
GO:0019222	0.453	regulation of metabolic process
GO:0060255	0.440	regulation of macromolecule metabolic process
GO:0048583	0.436	regulation of response to stimulus
GO:0002682	0.399	regulation of immune system process
GO:0009893	0.379	positive regulation of metabolic process
GO:0002684	0.373	positive regulation of immune system process
GO:0042221	0.328	response to chemical
GO:0048584	0.328	positive regulation of response to stimulus
GO:0010604	0.325	positive regulation of macromolecule metabolic process
GO:0007166	0.323	cell surface receptor signaling pathway
GO:0050776	0.319	regulation of immune response
GO:0010468	0.318	regulation of gene expression
GO:0009605	0.312	response to external stimulus
GO:0051240	0.311	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.982	extracellular region
GO:0043226	0.951	organelle
GO:0005615	0.948	extracellular space
GO:0043227	0.943	membrane-bounded organelle
GO:0031982	0.932	vesicle
GO:0005622	0.855	intracellular anatomical structure
GO:0065010	0.825	extracellular membrane-bounded organelle
GO:1903561	0.783	extracellular vesicle
GO:0070062	0.762	extracellular exosome
GO:0009986	0.748	cell surface
GO:0043231	0.684	intracellular membrane-bounded organelle
GO:0012505	0.494	endomembrane system
GO:0031410	0.491	cytoplasmic vesicle
GO:0032991	0.428	protein-containing complex
GO:0098588	0.353	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]