StarFunc result for job id P08648

User Input

>input (1049 residues)
MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFF
GFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRL
LESSLSSSEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLST
DNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQ
IAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTY
GYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQ
EVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFG
VDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSI
GFTVELQLDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDK
LSPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVF
GEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDY
FAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVV
SFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSI
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRS
SASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAV
YKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYIL
YKLGFFKRSLPYGTAMEKAQLKPPATSDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4g1eA	0.821	0.890	0.000	964	0.420	0.457	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
2	PDB:7nxdA	0.574	0.660	0.000	905	0.862	0.999	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
3	AFDB:A0A023GU64	0.846	0.839	0.000	1059	0.461	0.457	A0A023GU64.pdb.gz
4	AFDB:A0A0G2JVZ6	0.856	0.854	0.000	1052	0.438	0.436	A0A0G2JVZ6.pdb.gz	A0A0G2JVZ6_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=2
5	AFDB:A0A0G2K1E2	0.934	0.892	0.000	1099	0.899	0.858	A0A0G2K1E2.pdb.gz	A0A0G2K1E2_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=3 SV=2
6	AFDB:A2ARA8	0.905	0.894	0.000	1062	0.449	0.444	A2ARA8.pdb.gz	ITA8_MOUSE Integrin alpha-8 OS=Mus musculus OX=10090 GN=Itga8 PE=1 SV=1
7	AFDB:B3DIZ6	0.762	0.770	0.000	1037	0.384	0.389	B3DIZ6.pdb.gz
8	AFDB:B3DJQ3	0.870	0.873	0.000	1045	0.437	0.438	B3DJQ3.pdb.gz
9	AFDB:D3ZAC0	0.835	0.846	0.000	1034	0.379	0.385	D3ZAC0.pdb.gz	D3ZAC0_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=3
10	AFDB:G3HHR9	0.803	0.889	0.000	944	0.398	0.443	G3HHR9.pdb.gz	G3HHR9_CRIGR Integrin alpha-V OS=Cricetulus griseus OX=10029 GN=I79_010178 PE=3 SV=1
11	AFDB:L7RXH0	0.869	0.870	0.000	1048	0.454	0.454	L7RXH0.pdb.gz	L7RXH0_HUMAN Integrin, alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=3 SV=1
12	AFDB:P08514	0.829	0.837	0.000	1039	0.378	0.382	P08514.pdb.gz	ITA2B_HUMAN Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=3
13	PDB:3fcsA	0.773	0.882	1.428E-98	913	0.351	0.403	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
14	PDB:7uslA	0.547	0.648	6.813E-59	856	0.214	0.263	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
15	PDB:4nehA	0.566	0.551	1.257E-58	1084	0.213	0.206	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
16	PDB:4nenA	0.496	0.490	7.070E-57	1063	0.215	0.213	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
17	PDB:3k6sC	0.564	0.656	1.372E-56	885	0.211	0.250	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
18	PDB:4rtdA	0.097	0.093	3.716E-9	1122	0.072	0.068	4rtdA.pdb.gz
19	PDB:5a42A	0.092	0.070	1.473E-8	1597	0.088	0.058	5a42A.pdb.gz
20	PDB:4a7zA	0.195	0.224	1.631E-8	881	0.089	0.106	4a7zA.pdb.gz	Crystal Structure of Bifunctional Aldos-2-Ulose Dehydratase/Isomerase from Phanerochaete Chrysosporium with the Reaction Intermediate Ascopyrone M.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVZ6	786	1007	0.418	0.435	A0A0G2JVZ6_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=2
2	A0A0G2K1E2	1715	1098	0.857	0.819	A0A0G2K1E2_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=3 SV=2
3	A0A8I5Y696	869	1009	0.430	0.447	A0A8I5Y696_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
4	A0A8I5YCC9	1862	1050	0.900	0.899	A0A8I5YCC9_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=1 SV=1
5	A0A8I6A7G7	1813	1044	0.879	0.883	A0A8I6A7G7_RAT Integrin subunit alpha 5 OS=Rattus norvegicus OX=10116 GN=Itga5 PE=1 SV=1
6	A0A8I6GGN2	600	1037	0.382	0.387	A0A8I6GGN2_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=1
7	A0A8I6GID8	874	1063	0.443	0.437	A0A8I6GID8_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
8	A2ARA8	906	1062	0.446	0.441	ITA8_MOUSE Integrin alpha-8 OS=Mus musculus OX=10090 GN=Itga8 PE=1 SV=1
9	A2RQD8	906	1046	0.444	0.446	A2RQD8_PIG Alpha v integrin subunit variant OS=Sus scrofa OX=9823 GN=ITGAV PE=2 SV=1
10	B5DEG1	908	1062	0.448	0.443	B5DEG1_RAT RGD1564327 protein OS=Rattus norvegicus OX=10116 GN=Itga8 PE=2 SV=1
11	D3ZAC0	571	1020	0.363	0.374	D3ZAC0_RAT Integrin subunit alpha 2b OS=Rattus norvegicus OX=10116 GN=Itga2b PE=1 SV=3
12	F1LZX9	906	1042	0.446	0.449	F1LZX9_RAT Integrin subunit alpha V OS=Rattus norvegicus OX=10116 GN=Itgav PE=1 SV=4
13	F7F1E3	895	1086	0.448	0.433	F7F1E3_RAT Integrin subunit alpha 8 OS=Rattus norvegicus OX=10116 GN=Itga8 PE=1 SV=1
14	G3HHR9	794	944	0.402	0.447	G3HHR9_CRIGR Integrin alpha-V OS=Cricetulus griseus OX=10029 GN=I79_010178 PE=3 SV=1
15	L7RXH0	908	1048	0.447	0.448	L7RXH0_HUMAN Integrin, alpha V OS=Homo sapiens OX=9606 GN=ITGAV PE=3 SV=1
16	P06756	908	1048	0.447	0.448	ITAV_HUMAN Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=2
17	P08514	613	1039	0.378	0.382	ITA2B_HUMAN Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=3
18	P08648	2147	1049	1.000	1.000	ITA5_HUMAN Integrin alpha-5 OS=Homo sapiens OX=9606 GN=ITGA5 PE=1 SV=2
19	P11688	1883	1053	0.908	0.904	ITA5_MOUSE Integrin alpha-5 OS=Mus musculus OX=10090 GN=Itga5 PE=1 SV=3
20	P26008	910	1034	0.442	0.449	ITAV_CHICK Integrin alpha-V OS=Gallus gallus OX=9031 GN=ITGAV PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	1.3e-23	93.7	FG-GAP repeat
2	PF13517 FG-GAP_3	7.7e-07	40.9	FG-GAP-like repeat
3	PF00357 Integrin_alpha	12	17.2	Integrin alpha cytoplasmic region
4	PF08441 Integrin_alpha2	8.7e-110	379.6	Integrin alpha

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346839	0.999	Fibronectin type III domain containing
2	9606.ENSP00000379350	0.999	Integrin beta-1
3	9606.ENSP00000452786	0.997	Integrin beta-3
4	9606.ENSP00000296181	0.984	Integrin beta-5
5	9606.ENSP00000380948	0.980	Integrin beta-2
6	9606.ENSP00000316029	0.977	Talin-1
7	9606.ENSP00000267082	0.972	Integrin beta-7
8	9606.ENSP00000283249	0.971	Integrin beta-6
9	9606.ENSP00000347665	0.969	Collagen alpha-1(XVIII) chain
10	9606.ENSP00000222573	0.959	Integrin beta-8
11	9606.ENSP00000282561	0.956	Gap junction alpha-1 protein
12	9606.ENSP00000379975	0.956	Integrin-linked protein kinase
13	9606.ENSP00000341189	0.955	Focal adhesion kinase 1
14	9606.ENSP00000233809	0.954	Insulin-like growth factor-binding protein 2
15	9606.ENSP00000261937	0.954	Vascular endothelial growth factor receptor 3
16	9606.ENSP00000007722	0.949	Integrin alpha-3
17	9606.ENSP00000361850	0.947	Urokinase-type plasminogen activator
18	9606.ENSP00000161559	0.943	Carcinoembryonic antigen-related cell adhesion molecule 1
19	9606.ENSP00000306361	0.943	Fibrinogen alpha chain
20	9606.ENSP00000339328	0.941	Urokinase plasminogen activator surface receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	0.999	integrin binding
GO:0070851	0.996	growth factor receptor binding
GO:0005154	0.993	epidermal growth factor receptor binding
GO:0060089	0.781	molecular transducer activity
GO:0038023	0.729	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.996	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0032501	0.985	multicellular organismal process
GO:0007155	0.985	cell adhesion
GO:0051716	0.981	cellular response to stimulus
GO:0048518	0.980	positive regulation of biological process
GO:0007229	0.969	integrin-mediated signaling pathway
GO:0048522	0.965	positive regulation of cellular process
GO:0040017	0.959	positive regulation of locomotion
GO:0030155	0.945	regulation of cell adhesion
GO:0045785	0.940	positive regulation of cell adhesion
GO:2000147	0.937	positive regulation of cell motility
GO:0032502	0.926	developmental process
GO:0048856	0.921	anatomical structure development
GO:0030335	0.910	positive regulation of cell migration
GO:0010810	0.896	regulation of cell-substrate adhesion
GO:0010811	0.809	positive regulation of cell-substrate adhesion
GO:0044706	0.808	multi-multicellular organism process
GO:0007275	0.759	multicellular organism development
GO:0009653	0.601	anatomical structure morphogenesis
GO:0048731	0.557	system development
GO:0044703	0.525	multi-organism reproductive process
GO:0007565	0.508	female pregnancy
GO:0071840	0.493	cellular component organization or biogenesis
GO:0051239	0.461	regulation of multicellular organismal process
GO:0019222	0.459	regulation of metabolic process
GO:0031589	0.446	cell-substrate adhesion
GO:0016043	0.445	cellular component organization
GO:0048519	0.410	negative regulation of biological process
GO:0048583	0.409	regulation of response to stimulus
GO:0060255	0.401	regulation of macromolecule metabolic process
GO:0048523	0.385	negative regulation of cellular process
GO:0023051	0.384	regulation of signaling
GO:0010646	0.384	regulation of cell communication
GO:0051171	0.377	regulation of nitrogen compound metabolic process
GO:0009893	0.377	positive regulation of metabolic process
GO:0031323	0.375	regulation of cellular metabolic process
GO:0010604	0.360	positive regulation of macromolecule metabolic process
GO:0080090	0.356	regulation of primary metabolic process
GO:0048870	0.350	cell motility
GO:0098609	0.347	cell-cell adhesion
GO:0030154	0.342	cell differentiation
GO:0016477	0.332	cell migration
GO:0009888	0.321	tissue development
GO:0009966	0.317	regulation of signal transduction
GO:0048646	0.308	anatomical structure formation involved in morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030054	0.997	cell junction
GO:0032991	0.996	protein-containing complex
GO:0005737	0.995	cytoplasm
GO:0098636	0.993	protein complex involved in cell adhesion
GO:0098802	0.987	plasma membrane signaling receptor complex
GO:0005576	0.983	extracellular region
GO:0008305	0.982	integrin complex
GO:0012505	0.961	endomembrane system
GO:0043227	0.959	membrane-bounded organelle
GO:0005615	0.954	extracellular space
GO:0043231	0.906	intracellular membrane-bounded organelle
GO:0098590	0.894	plasma membrane region
GO:0031982	0.858	vesicle
GO:0009986	0.857	cell surface
GO:0005925	0.832	focal adhesion
GO:1903561	0.817	extracellular vesicle
GO:0070062	0.801	extracellular exosome
GO:0045202	0.729	synapse
GO:0098978	0.708	glutamatergic synapse
GO:0098794	0.661	postsynapse
GO:0097060	0.651	synaptic membrane
GO:0045211	0.602	postsynaptic membrane
GO:0043233	0.445	organelle lumen
GO:0070013	0.444	intracellular organelle lumen
GO:0031410	0.349	cytoplasmic vesicle
GO:0005829	0.345	cytosol
GO:0031090	0.304	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]