StarFunc result for job id P08651

User Input

>input (508 residues)
MYSSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDE
LLGEKPEVKQKWASRLLAKLRKDIRPECREDFVLSITGKKAPGCVLSNPDQKGKMRRIDC
LRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYL
AYFVRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVV
TGTGPNFSLGELQGHLAYDLNPASTGLRRTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYY
TSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVH
SGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQ
PGPLNGSGQLKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPD
TSPANRSFVGLGPRDPAGIYQAQSWYLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286YEX4	0.451	0.433	1.737E-65	530	0.988	0.947	A0A286YEX4.pdb.gz	A0A286YEX4_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=1
2	AFDB:B1AKN8	0.504	0.484	2.928E-47	532	0.630	0.602	B1AKN8.pdb.gz	B1AKN8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
3	AFDB:B1AKN5	0.440	0.459	1.820E-45	487	0.632	0.659	B1AKN5.pdb.gz	B1AKN5_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
4	AFDB:Q14938	0.534	0.539	1.978E-43	502	0.589	0.596	Q14938.pdb.gz	NFIX_HUMAN Nuclear factor 1 X-type OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=2
5	AFDB:P97863	0.460	0.412	5.400E-43	570	0.614	0.547	P97863.pdb.gz	NFIB_MOUSE Nuclear factor 1 B-type OS=Mus musculus OX=10090 GN=Nfib PE=1 SV=2
6	AFDB:B1AKN7	0.477	0.515	1.949E-42	466	0.602	0.657	B1AKN7.pdb.gz	B1AKN7_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
7	AFDB:Q5VW27	0.484	0.504	3.358E-41	487	0.559	0.583	Q5VW27.pdb.gz	Q5VW27_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
8	AFDB:C9JWJ8	0.453	0.559	3.216E-38	403	0.482	0.608	C9JWJ8.pdb.gz	C9JWJ8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=3
9	AFDB:A0A0R4IU09	0.433	0.507	1.298E-37	432	0.472	0.556	A0A0R4IU09.pdb.gz
10	AFDB:A0A1B0GVN4	0.203	0.243	3.240E-23	424	0.488	0.585	A0A1B0GVN4.pdb.gz	A0A1B0GVN4_HUMAN Nuclear factor I B OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
11	PDB:7p9uB	0.057	0.062	5.096	455	0.028	0.031	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
12	PDB:2v4jC	0.049	0.224	6.371	103	0.031	0.155	2v4jC.pdb.gz	The Crystal Structure of Desulfovibrio Vulgaris Dissimilatory Sulfite Reductase Bound to Dsrc Provides Novel Insights Into the Mechanism of Sulfate Respiration.
13	PDB:4v6wCT	0.045	0.092	7.532	158	0.022	0.070	4v6wCT.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:7bt6r	0.059	0.103	7.532	230	0.031	0.070	7bt6r.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
15	PDB:6rw4O	0.070	0.139	9.415	194	0.043	0.113	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
16	PDB:7o4iW	0.053	0.074	9.415	312	0.039	0.064	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286YEX4	1022	530	0.980	0.940	A0A286YEX4_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=1
2	A0A2R8Y7V8	534	566	0.606	0.544	A0A2R8Y7V8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
3	A0A590UK09	519	508	0.620	0.620	A0A590UK09_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
4	A0A8I5ZTI5	812	429	0.793	0.939	A0A8I5ZTI5_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfic PE=1 SV=1
5	A0A8I5ZYT8	830	511	0.787	0.783	A0A8I5ZYT8_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfic PE=1 SV=1
6	A0A8I5ZZR6	853	428	0.807	0.958	A0A8I5ZZR6_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfic PE=1 SV=1
7	A0A8I6AFY4	545	570	0.616	0.549	A0A8I6AFY4_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
8	A0A8I6AMP4	828	461	0.787	0.868	A0A8I6AMP4_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfic PE=1 SV=1
9	A0A8J8YK50	558	503	0.624	0.630	A0A8J8YK50_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
10	B1AKN5	522	487	0.624	0.651	B1AKN5_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
11	F7EL25	728	397	0.724	0.927	F7EL25_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfic PE=1 SV=1
12	F7F711	531	491	0.604	0.625	F7F711_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
13	O70185	532	561	0.604	0.547	O70185_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=2
14	O70186	545	494	0.612	0.630	O70186_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=2
15	O70188	852	439	0.807	0.934	O70188_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfic PE=1 SV=2
16	P08651	1044	508	1.000	1.000	NFIC_HUMAN Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=2
17	P09414	531	509	0.634	0.633	NFIA_RAT Nuclear factor 1 A-type OS=Rattus norvegicus OX=10116 GN=Nfia PE=1 SV=2
18	P70255	830	439	0.803	0.929	NFIC_MOUSE Nuclear factor 1 C-type OS=Mus musculus OX=10090 GN=Nfic PE=1 SV=1
19	P97863	546	570	0.618	0.551	NFIB_MOUSE Nuclear factor 1 B-type OS=Mus musculus OX=10090 GN=Nfib PE=1 SV=2
20	Q12857	530	509	0.634	0.633	NFIA_HUMAN Nuclear factor 1 A-type OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00859 CTF_NFI	9.9e-131	447.4	CTF/NF-I family transcription modulation region
2	PF03165 MH1	1.3e-07	43.1	MH1 domain
3	PF10524 NfI_DNAbd_pre-N	3.7e-23	92.4	Nuclear factor I protein pre-N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396843

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326366	0.912	Presenilin-1
2	9606.ENSP00000478533	0.911	Neurotrophin receptor-interacting factor homolog
3	9606.ENSP00000294785	0.908	Nicastrin
4	9606.ENSP00000468411	0.907	Gamma-secretase subunit PEN-2
5	9606.ENSP00000380904	0.904	DNA-directed RNA polymerase III subunit RPC4
6	9606.ENSP00000401566	0.904	Protein ecdysoneless homolog
7	9606.ENSP00000293860	0.902	DNA-directed RNA polymerase III subunit RPC10
8	9606.ENSP00000414303	0.902	Brain-derived neurotrophic factor
9	9606.ENSP00000261879	0.901	Gamma-secretase subunit APH-1B
10	9606.ENSP00000309968	0.901	Disintegrin and metalloproteinase domain-containing protein 17
11	9606.ENSP00000358105	0.901	Gamma-secretase subunit APH-1A
12	9606.ENSP00000378736	0.901	DNA-directed RNA polymerase III subunit RPC9
13	9606.ENSP00000172229	0.900	Tumor necrosis factor receptor superfamily member 16
14	9606.ENSP00000228347	0.900	DNA-directed RNA polymerase III subunit RPC2
15	9606.ENSP00000256637	0.900	Sortilin
16	9606.ENSP00000299314	0.900	N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
17	9606.ENSP00000299853	0.900	DNA-directed RNA polymerase III subunit RPC5
18	9606.ENSP00000302478	0.900	DNA-directed RNA polymerases I and III subunit RPAC2
19	9606.ENSP00000324124	0.900	DNA-directed RNA polymerases I, II, and III subunit RPABC5
20	9606.ENSP00000334564	0.900	DNA-directed RNA polymerase III subunit RPC3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000987	1.000	cis-regulatory region sequence-specific DNA binding
GO:0005515	0.999	protein binding
GO:0000981	0.985	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.813	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.812	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.988	regulation of DNA-templated transcription
GO:0045892	0.980	negative regulation of DNA-templated transcription
GO:0048518	0.965	positive regulation of biological process
GO:0010604	0.963	positive regulation of macromolecule metabolic process
GO:0051173	0.900	positive regulation of nitrogen compound metabolic process
GO:0009987	0.892	cellular process
GO:0048522	0.826	positive regulation of cellular process
GO:0045893	0.781	positive regulation of DNA-templated transcription
GO:0071704	0.694	organic substance metabolic process
GO:0006807	0.640	nitrogen compound metabolic process
GO:0044238	0.612	primary metabolic process
GO:0044237	0.562	cellular metabolic process
GO:0043170	0.529	macromolecule metabolic process
GO:0006357	0.505	regulation of transcription by RNA polymerase II
GO:0010467	0.503	gene expression
GO:0045944	0.471	positive regulation of transcription by RNA polymerase II
GO:0006351	0.362	DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0005730	0.674	nucleolus
GO:0005737	0.526	cytoplasm
GO:0001650	0.520	fibrillar center
GO:0005829	0.501	cytosol
GO:0032991	0.493	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]