StarFunc result for job id P08697

User Input

>input (491 residues)
MALLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVSPLTLLKLGNQEPGGQ
TALKSPPGVCSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHL
ALGAQNHTLQRLQQVLHAGSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLE
QSEQLFGAKPVSLTGKQEDDLANINQWVKEATEGKIQEFLSGLPEDTVLLLLNAIHFQGF
WRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVV
LVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELF
QAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF
EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPM
EEDYPQFGSPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08697	1.000	1.000	3.611E-100	491	1.000	1.000	P08697.pdb.gz	A2AP_HUMAN Alpha-2-antiplasmin OS=Homo sapiens OX=9606 GN=SERPINF2 PE=1 SV=3
2	AFDB:Q61247	0.781	0.781	5.891E-74	491	0.745	0.745	Q61247.pdb.gz	A2AP_MOUSE Alpha-2-antiplasmin OS=Mus musculus OX=10090 GN=Serpinf2 PE=1 SV=1
3	AFDB:F7FHF3	0.780	0.694	7.364E-74	554	0.731	0.648	F7FHF3.pdb.gz	F7FHF3_RAT Serpin family F member 2 OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=1 SV=1
4	PDB:2r9yA	0.730	0.979	4.020E-60	365	0.597	0.803	2r9yA.pdb.gz
5	AFDB:A0A384MDV8	0.688	0.676	2.631E-40	500	0.244	0.240	A0A384MDV8.pdb.gz	A0A384MDV8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
6	AFDB:Q80ZA3	0.704	0.822	7.906E-39	418	0.234	0.275	Q80ZA3.pdb.gz	Q80ZA3_RAT Serine (Or cysteine) peptidase inhibitor, clade F, member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=2 SV=1
7	AFDB:Q6P734	0.685	0.668	1.381E-38	504	0.228	0.222	Q6P734.pdb.gz	IC1_RAT Plasma protease C1 inhibitor OS=Rattus norvegicus OX=10116 GN=Serping1 PE=2 SV=1
8	AFDB:Q95121	0.701	0.822	4.982E-38	416	0.232	0.274	Q95121.pdb.gz	PEDF_BOVIN Pigment epithelium-derived factor OS=Bos taurus OX=9913 GN=SERPINF1 PE=1 SV=1
9	AFDB:P97290	0.708	0.691	7.785E-38	504	0.234	0.228	P97290.pdb.gz	IC1_MOUSE Plasma protease C1 inhibitor OS=Mus musculus OX=10090 GN=Serping1 PE=1 SV=3
10	AFDB:P36955	0.699	0.817	9.203E-38	418	0.238	0.280	P36955.pdb.gz	PEDF_HUMAN Pigment epithelium-derived factor OS=Homo sapiens OX=9606 GN=SERPINF1 PE=1 SV=4
11	AFDB:P07759	0.698	0.814	6.484E-37	418	0.232	0.273	P07759.pdb.gz	SPA3K_MOUSE Serine protease inhibitor A3K OS=Mus musculus OX=10090 GN=Serpina3k PE=1 SV=2
12	PDB:1imvA	0.684	0.888	6.871E-37	375	0.218	0.285	1imvA.pdb.gz
13	PDB:1hp7A	0.667	0.860	1.182E-35	376	0.202	0.263	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
14	PDB:6losA	0.680	0.897	1.250E-35	369	0.220	0.293	6losA.pdb.gz	Spatiotemporal regulation of PEDF signaling by type I collagen remodeling.
15	PDB:1jmoA	0.670	0.765	7.333E-34	427	0.210	0.241	1jmoA.pdb.gz
16	PDB:4ga7A	0.677	0.894	1.893E-33	369	0.218	0.290	4ga7A.pdb.gz
17	PDB:2zv6B	0.670	0.877	3.307E-33	371	0.204	0.270	2zv6B.pdb.gz
18	PDB:4dteA	0.657	0.849	4.621E-33	374	0.206	0.270	4dteA.pdb.gz
19	PDB:1yxaA	0.641	0.836	5.463E-33	372	0.218	0.288	1yxaA.pdb.gz
20	PDB:3f1sA	0.690	0.873	5.776E-33	385	0.202	0.257	3f1sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AQI7	0.0	660	561	0.701	0.613	A0A8I6AQI7_RAT Serpin family F member 2 OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=1 SV=1
2	F7FHF3	0.0	680	554	0.711	0.630	F7FHF3_RAT Serpin family F member 2 OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=1 SV=1
3	P08697	0.0	996	491	1.000	1.000	A2AP_HUMAN Alpha-2-antiplasmin OS=Homo sapiens OX=9606 GN=SERPINF2 PE=1 SV=3
4	Q61247	0.0	712	491	0.725	0.725	A2AP_MOUSE Alpha-2-antiplasmin OS=Mus musculus OX=10090 GN=Serpinf2 PE=1 SV=1
5	Q68FT8	0.0	681	491	0.711	0.711	Q68FT8_RAT RCG33981, isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Serpinf2 PE=2 SV=1
6	Q80ZA3	2.59e-49	176	418	0.228	0.268	Q80ZA3_RAT Serine (Or cysteine) peptidase inhibitor, clade F, member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=2 SV=1
7	P36955	2.96e-49	176	418	0.222	0.261	PEDF_HUMAN Pigment epithelium-derived factor OS=Homo sapiens OX=9606 GN=SERPINF1 PE=1 SV=4
8	P97298	8.87e-48	172	417	0.224	0.264	PEDF_MOUSE Pigment epithelium-derived factor OS=Mus musculus OX=10090 GN=Serpinf1 PE=1 SV=2
9	Q95121	1.25e-47	172	416	0.232	0.274	PEDF_BOVIN Pigment epithelium-derived factor OS=Bos taurus OX=9913 GN=SERPINF1 PE=1 SV=1
10	A0A8J8XL70	4.10e-43	159	411	0.222	0.265	A0A8J8XL70_RAT Serpin family F member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=1 SV=1
11	P97290	4.55e-43	161	504	0.222	0.216	IC1_MOUSE Plasma protease C1 inhibitor OS=Mus musculus OX=10090 GN=Serping1 PE=1 SV=3
12	Q9TTE1	5.13e-43	159	411	0.251	0.299	SPA31_BOVIN Serpin A3-1 OS=Bos taurus OX=9913 GN=SERPINA3-1 PE=1 SV=3
13	Q8BHL1	1.55e-42	157	387	0.248	0.315	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
14	Q6UKZ2	1.96e-42	157	387	0.248	0.315	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
15	Q6P734	4.25e-42	159	504	0.218	0.212	IC1_RAT Plasma protease C1 inhibitor OS=Rattus norvegicus OX=10116 GN=Serping1 PE=2 SV=1
16	Q9D1Q5	1.47e-41	154	387	0.246	0.313	Q9D1Q5_MOUSE Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=1 SV=1
17	A0A384MDV8	2.27e-41	156	500	0.224	0.220	A0A384MDV8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
18	P05155	3.06e-41	156	500	0.224	0.220	IC1_HUMAN Plasma protease C1 inhibitor OS=Homo sapiens OX=9606 GN=SERPING1 PE=1 SV=2
19	Q7ZZW1	6.93e-41	154	426	0.230	0.265	Q7ZZW1_ONCMY Alpha-1-antiproteinase-like protein OS=Oncorhynchus mykiss OX=8022 GN=antiprot1 PE=2 SV=1
20	Q9D154	9.19e-41	152	379	0.246	0.319	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00079 Serpin	8e-85	297.0	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321853

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308938	0.998	Plasminogen
2	9606.ENSP00000220809	0.979	Tissue-type plasminogen activator
3	9606.ENSP00000234071	0.925	Vitamin K-dependent protein C
4	9606.ENSP00000306361	0.916	Fibrinogen alpha chain
5	9606.ENSP00000336829	0.898	Fibrinogen gamma chain
6	9606.ENSP00000346839	0.892	Fibronectin type III domain containing
7	9606.ENSP00000308541	0.884	Prothrombin
8	9606.ENSP00000306099	0.875	Fibrinogen beta chain
9	9606.ENSP00000361850	0.845	Urokinase-type plasminogen activator
10	9606.ENSP00000181383	0.836	Carboxypeptidase B2
11	9606.ENSP00000466090	0.819	Neutrophil elastase
12	9606.ENSP00000381133	0.811	Fibrinogen-like protein 1
13	9606.ENSP00000260356	0.799	Thrombospondin-1
14	9606.ENSP00000323929	0.784	Alpha-2-macroglobulin
15	9606.ENSP00000334145	0.760	Tissue factor
16	9606.ENSP00000248598	0.756	Fibroleukin
17	9606.ENSP00000364731	0.733	Coagulation factor VII
18	9606.ENSP00000384957	0.720	Coagulation factor XI
19	9606.ENSP00000232003	0.713	Histidine-rich glycoprotein
20	9606.ENSP00000438615	0.688	Complement C1r subcomponent

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0005515	0.999	protein binding
GO:0046983	0.756	protein dimerization activity
GO:0042802	0.660	identical protein binding
GO:0002020	0.308	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065008	0.993	regulation of biological quality
GO:0048583	0.985	regulation of response to stimulus
GO:0061041	0.980	regulation of wound healing
GO:0048518	0.978	positive regulation of biological process
GO:0050878	0.957	regulation of body fluid levels
GO:0048519	0.949	negative regulation of biological process
GO:0050794	0.947	regulation of cellular process
GO:0090303	0.946	positive regulation of wound healing
GO:0051240	0.945	positive regulation of multicellular organismal process
GO:1900046	0.937	regulation of hemostasis
GO:0050896	0.915	response to stimulus
GO:0032101	0.911	regulation of response to external stimulus
GO:0030193	0.879	regulation of blood coagulation
GO:0001817	0.854	regulation of cytokine production
GO:0009966	0.824	regulation of signal transduction
GO:0032956	0.793	regulation of actin cytoskeleton organization
GO:0051495	0.779	positive regulation of cytoskeleton organization
GO:1902905	0.777	positive regulation of supramolecular fiber organization
GO:0051171	0.754	regulation of nitrogen compound metabolic process
GO:0032231	0.751	regulation of actin filament bundle assembly
GO:0009893	0.725	positive regulation of metabolic process
GO:0032233	0.722	positive regulation of actin filament bundle assembly
GO:0080090	0.715	regulation of primary metabolic process
GO:0048585	0.682	negative regulation of response to stimulus
GO:0009987	0.678	cellular process
GO:0009967	0.666	positive regulation of signal transduction
GO:0051492	0.658	regulation of stress fiber assembly
GO:0051496	0.649	positive regulation of stress fiber assembly
GO:1902531	0.622	regulation of intracellular signal transduction
GO:0051246	0.603	regulation of protein metabolic process
GO:1903035	0.602	negative regulation of response to wounding
GO:0032102	0.581	negative regulation of response to external stimulus
GO:0043408	0.534	regulation of MAPK cascade
GO:0010604	0.523	positive regulation of macromolecule metabolic process
GO:0009892	0.498	negative regulation of metabolic process
GO:1902533	0.483	positive regulation of intracellular signal transduction
GO:0032501	0.453	multicellular organismal process
GO:0010714	0.450	positive regulation of collagen metabolic process
GO:0071634	0.449	regulation of transforming growth factor beta production
GO:0051241	0.443	negative regulation of multicellular organismal process
GO:0061045	0.415	negative regulation of wound healing
GO:0032965	0.396	regulation of collagen biosynthetic process
GO:0048523	0.387	negative regulation of cellular process
GO:1903317	0.381	regulation of protein maturation
GO:0030162	0.380	regulation of proteolysis
GO:0010605	0.356	negative regulation of macromolecule metabolic process
GO:0010628	0.336	positive regulation of gene expression
GO:0045861	0.312	negative regulation of proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0012505	0.997	endomembrane system
GO:0071944	0.996	cell periphery
GO:0031982	0.996	vesicle
GO:0005737	0.995	cytoplasm
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0070062	0.993	extracellular exosome
GO:0070013	0.987	intracellular organelle lumen
GO:0060205	0.965	cytoplasmic vesicle lumen
GO:0062023	0.944	collagen-containing extracellular matrix
GO:0032991	0.942	protein-containing complex
GO:0072562	0.940	blood microparticle
GO:0030141	0.910	secretory granule
GO:0034774	0.901	secretory granule lumen
GO:0031091	0.793	platelet alpha granule
GO:0031093	0.758	platelet alpha granule lumen
GO:0009986	0.739	cell surface
GO:0016020	0.638	membrane
GO:0005783	0.589	endoplasmic reticulum
GO:0005886	0.449	plasma membrane
GO:0005788	0.443	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]