StarFunc result for job id P08727

User Input

>input (400 residues)
MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA
YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA
PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08727	1.000	1.000	8.355E-53	400	1.000	1.000	P08727.pdb.gz	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
2	AFDB:P19001	0.540	0.536	4.470E-43	403	0.825	0.819	P19001.pdb.gz	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
3	AFDB:Q63279	0.524	0.521	1.082E-42	403	0.820	0.814	Q63279.pdb.gz	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2
4	AFDB:Q6PVZ1	0.688	0.602	8.524E-34	467	0.665	0.570	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
5	AFDB:Q6IFU8	0.656	0.613	4.997E-33	433	0.652	0.603	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
6	AFDB:P19012	0.552	0.494	1.848E-31	456	0.652	0.572	P19012.pdb.gz	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
7	AFDB:Q61414	0.533	0.480	6.009E-31	452	0.637	0.564	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
8	AFDB:P08779	0.484	0.421	1.815E-30	473	0.652	0.552	P08779.pdb.gz	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
9	AFDB:P02533	0.418	0.366	2.437E-30	472	0.645	0.547	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
10	AFDB:Q6IFV1	0.392	0.332	3.791E-30	485	0.605	0.499	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
11	PDB:8at3A	0.159	0.207	6.223	286	0.107	0.150	8at3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08727	0.0	807	400	1.000	1.000	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
2	P19001	0.0	626	403	0.828	0.821	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
3	Q63279	0.0	606	403	0.820	0.814	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2
4	Q9QWL7	1.67e-176	500	433	0.632	0.584	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
5	Q6IFU8	1.02e-175	498	433	0.630	0.582	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
6	Q04695	6.66e-172	489	432	0.585	0.542	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
7	Q61414	1.76e-166	476	452	0.565	0.500	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
8	Q6IFV3	1.16e-164	471	447	0.557	0.499	K1C15_RAT Keratin, type I cytoskeletal 15 OS=Rattus norvegicus OX=10116 GN=Krt15 PE=1 SV=1
9	Q6IFV1	3.36e-164	471	485	0.552	0.456	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
10	Q6IFV4	8.13e-164	468	438	0.625	0.571	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
11	P08779	1.48e-163	469	473	0.565	0.478	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
12	P19012	1.70e-163	468	456	0.557	0.489	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
13	Q61781	3.94e-163	468	484	0.552	0.457	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2
14	K7ERE3	9.81e-163	465	415	0.557	0.537	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
15	P08730	2.47e-162	464	437	0.620	0.568	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
16	P13646	4.36e-162	465	458	0.557	0.487	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
17	P02533	4.68e-162	465	472	0.552	0.468	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
18	A1A4E9	2.05e-161	463	458	0.555	0.485	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
19	Q9Z2K1	4.11e-149	432	469	0.517	0.441	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
20	Q99456	1.61e-145	424	494	0.525	0.425	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	3.7e+02	12.6	Afadin- and alpha -actinin-Binding
2	PF10186 ATG14	2.9e+02	11.9	Vacuolar sorting 38 and autophagy-related subunit 14
3	PF05791 Bacillus_HBL	90	14.3	Bacillus haemolytic enterotoxin (HBL)
4	PF07889 DUF1664	56	15.2	Protein of unknown function (DUF1664)
5	PF17601 DUF5497	8.6e+02	11.7	Family of unknown function (DUF5497)
6	PF00038 Filament	4e-115	396.3	Intermediate filament protein
7	PF14282 FlxA	7.3e+02	11.7	FlxA-like protein
8	PF09787 Golgin_A5	58	14.6	Golgin subfamily A member 5
9	PF02996 Prefoldin	13	17.2	Prefoldin subunit
10	PF07926 TPR_MLP1_2	3.6e+02	12.6	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355124

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263735	0.913	Epithelial cell adhesion molecule
2	9606.ENSP00000229795	0.906	Mitogen-activated protein kinase 14
3	9606.ENSP00000333685	0.900	Mitogen-activated protein kinase 11
4	9606.ENSP00000354923	0.892	Dystrophin
5	9606.ENSP00000221992	0.862	Carcinoembryonic antigen-related cell adhesion molecule 5
6	9606.ENSP00000379138	0.844	Alpha-fetoprotein
7	9606.ENSP00000269571	0.811	Receptor tyrosine-protein kinase erbB-2
8	9606.ENSP00000449404	0.789	Keratin, type II cytoskeletal 8
9	9606.ENSP00000261769	0.754	Cadherin-1
10	9606.ENSP00000484824	0.748	Mucin-1
11	9606.ENSP00000331678	0.736	Plakophilin-3
12	9606.ENSP00000245479	0.735	Transcription factor SOX-9
13	9606.ENSP00000336831	0.733	Plastin-1
14	9606.ENSP00000437402	0.731	Gamma-enolase
15	9606.ENSP00000426809	0.717	Prominin-1
16	9606.ENSP00000295897	0.706	Serum albumin
17	9606.ENSP00000373487	0.696	Keratin, type I cytoskeletal 18
18	9606.ENSP00000353475	0.694	Claudin-7
19	9606.ENSP00000344456	0.688	Catenin beta-1
20	9606.ENSP00000377836	0.686	Glypican-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.903	structural molecule activity
GO:0005200	0.754	structural constituent of cytoskeleton
GO:0008307	0.671	structural constituent of muscle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0048856	0.985	anatomical structure development
GO:0050789	0.788	regulation of biological process
GO:0050794	0.766	regulation of cellular process
GO:0050896	0.763	response to stimulus
GO:0071840	0.744	cellular component organization or biogenesis
GO:0016043	0.716	cellular component organization
GO:0032501	0.691	multicellular organismal process
GO:0048869	0.479	cellular developmental process
GO:0030154	0.454	cell differentiation
GO:0009653	0.424	anatomical structure morphogenesis
GO:0051716	0.388	cellular response to stimulus
GO:0007275	0.388	multicellular organism development
GO:0006996	0.386	organelle organization
GO:0048513	0.343	animal organ development
GO:0042221	0.310	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005886	0.990	plasma membrane
GO:0005856	0.988	cytoskeleton
GO:0099081	0.979	supramolecular polymer
GO:0099512	0.974	supramolecular fiber
GO:0005576	0.971	extracellular region
GO:0005829	0.965	cytosol
GO:0043227	0.953	membrane-bounded organelle
GO:0045111	0.946	intermediate filament cytoskeleton
GO:0005615	0.848	extracellular space
GO:0043231	0.789	intracellular membrane-bounded organelle
GO:1903561	0.777	extracellular vesicle
GO:0070062	0.730	extracellular exosome
GO:0099513	0.558	polymeric cytoskeletal fiber
GO:0032991	0.428	protein-containing complex
GO:0005634	0.383	nucleus
GO:0005882	0.381	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]