StarFunc result for job id P08729

User Input

>input (469 residues)
MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVG
AGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLE
TKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKY
EDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQI
SDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD
LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAA
LQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG
GSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08729	1.000	1.000	5.065E-55	469	1.000	1.000	P08729.pdb.gz	K2C7_HUMAN Keratin, type II cytoskeletal 7 OS=Homo sapiens OX=9606 GN=KRT7 PE=1 SV=5
2	AFDB:Q9DCV7	0.451	0.461	1.722E-43	457	0.810	0.832	Q9DCV7.pdb.gz	K2C7_MOUSE Keratin, type II cytoskeletal 7 OS=Mus musculus OX=10090 GN=Krt7 PE=1 SV=1
3	AFDB:A0A1D5PXP0	0.394	0.357	1.004E-30	522	0.633	0.569	A0A1D5PXP0.pdb.gz
4	AFDB:P13647	0.394	0.324	1.573E-30	590	0.638	0.507	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
5	AFDB:Q6PVZ5	0.385	0.308	3.083E-30	599	0.620	0.486	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
6	AFDB:Q8BGZ7	0.490	0.423	1.100E-29	551	0.618	0.526	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
7	AFDB:P02538	0.408	0.348	1.376E-29	564	0.606	0.504	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
8	AFDB:Q922U2	0.432	0.360	2.503E-29	580	0.608	0.491	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
9	AFDB:Q9Z331	0.427	0.367	4.554E-29	562	0.603	0.504	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
10	AFDB:O95678	0.477	0.416	6.142E-29	551	0.623	0.530	O95678.pdb.gz	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
11	PDB:5lj5O	0.075	0.109	2.813	283	0.047	0.078	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:3javA	0.100	0.022	4.088	2327	0.038	0.008	3javA.pdb.gz
13	PDB:7mqaNA	0.054	0.077	5.514	295	0.045	0.071	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6mdmH	0.078	0.214	6.901	147	0.053	0.170	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
15	PDB:7d4iRJ	0.128	0.085	6.901	738	0.038	0.024	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
16	PDB:5wlcST	0.136	0.109	7.437	599	0.028	0.022	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
17	PDB:7mqaSI	0.099	0.062	8.015	803	0.034	0.020	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95678	0.0	530	551	0.608	0.517	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
2	P02538	0.0	527	564	0.567	0.472	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
3	P04259	0.0	522	564	0.563	0.468	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
4	P08729	0.0	944	469	1.000	1.000	K2C7_HUMAN Keratin, type II cytoskeletal 7 OS=Homo sapiens OX=9606 GN=KRT7 PE=1 SV=5
5	P13647	0.0	524	590	0.557	0.442	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
6	P48668	0.0	523	564	0.561	0.466	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
7	P50446	0.0	524	553	0.559	0.474	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
8	Q6P6Q2	0.0	532	576	0.580	0.472	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
9	Q8BGZ7	0.0	521	551	0.552	0.470	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
10	Q922U2	0.0	520	580	0.552	0.447	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
11	Q9DCV7	0.0	758	457	0.812	0.834	K2C7_MOUSE Keratin, type II cytoskeletal 7 OS=Mus musculus OX=10090 GN=Krt7 PE=1 SV=1
12	Q6PVZ5	4.96e-180	518	599	0.554	0.434	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
13	Q9Z331	8.28e-180	516	562	0.548	0.457	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
14	P05787	1.51e-175	503	483	0.565	0.549	K2C8_HUMAN Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7
15	Q10758	2.60e-175	502	483	0.559	0.542	K2C8_RAT Keratin, type II cytoskeletal 8 OS=Rattus norvegicus OX=10116 GN=Krt8 PE=1 SV=3
16	P11679	1.41e-173	498	490	0.554	0.531	K2C8_MOUSE Keratin, type II cytoskeletal 8 OS=Mus musculus OX=10090 GN=Krt8 PE=1 SV=4
17	P19013	1.99e-170	491	520	0.525	0.473	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
18	P07744	1.88e-169	489	525	0.512	0.457	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
19	F1QV31	5.60e-169	489	566	0.522	0.433	F1QV31_DANRE Keratin 5 OS=Danio rerio OX=7955 GN=ckii PE=1 SV=1
20	Q6P3K5	9.19e-169	488	553	0.522	0.443	Q6P3K5_DANRE Krt5 protein OS=Danio rerio OX=7955 GN=krt5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	6.6e+02	11.8	Afadin- and alpha -actinin-Binding
2	PF08614 ATG16	82	14.8	Autophagy protein 16 (ATG16)
3	PF04513 Baculo_PEP_C	6.7e+02	11.7	Baculovirus polyhedron envelope protein, PEP, C terminus
4	PF07888 CALCOCO1	1.9e+02	12.3	Calcium binding and coiled-coil domain (CALCOCO1) like
5	PF10473 CENP-F_leu_zip	10	17.6	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
6	PF16888 DUF5082	9.6	17.9	Domain of unknown function (DUF5082)
7	PF00038 Filament	7.1e-113	388.9	Intermediate filament protein
8	PF16208 Keratin_2_head	4.5e-06	38.3	Keratin type II head
9	PF05531 NPV_P10	2.1e+02	13.8	Nucleopolyhedrovirus P10 protein
10	PF02996 Prefoldin	34	15.8	Prefoldin subunit
11	PF05546 She9_MDM33	43	15.3	She9 / Mdm33 family
12	PF09728 Taxilin	83	13.8	Myosin-like coiled-coil protein
13	PF07926 TPR_MLP1_2	0.079	24.4	TPR/MLP1/MLP2-like protein
14	PF15739 TSNAXIP1_N	6.8	18.4	Translin-associated factor X-interacting N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370408	0.875	Homeobox protein CDX-2
2	9606.ENSP00000253719	0.860	Napsin-A
3	9606.ENSP00000291009	0.856	Prolactin induced protein
4	9606.ENSP00000346879	0.856	Homeobox protein Nkx-2.1
5	9606.ENSP00000221992	0.855	Carcinoembryonic antigen-related cell adhesion molecule 5
6	9606.ENSP00000263233	0.829	Synaptophysin
7	9606.ENSP00000263334	0.828	Paired box protein Pax-8
8	9606.ENSP00000418525	0.810	Neprilysin
9	9606.ENSP00000371517	0.809	Alpha-methylacyl-CoA racemase
10	9606.ENSP00000373487	0.795	Keratin, type I cytoskeletal 18
11	9606.ENSP00000379138	0.786	Alpha-fetoprotein
12	9606.ENSP00000485659	0.772	Mucin-5AC
13	9606.ENSP00000295897	0.758	Serum albumin
14	9606.ENSP00000307508	0.758	Calretinin
15	9606.ENSP00000484824	0.758	Mucin-1
16	9606.ENSP00000216492	0.736	Chromogranin-A
17	9606.ENSP00000406861	0.732	Mucin-6
18	9606.ENSP00000331327	0.724	Wilms tumor protein
19	9606.ENSP00000370886	0.717	Melanoma antigen recognized by T-cells 1
20	9606.ENSP00000480132	0.715	Neural cell adhesion molecule 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.363	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.786	biological regulation
GO:0050789	0.775	regulation of biological process
GO:0050794	0.718	regulation of cellular process
GO:0032502	0.651	developmental process
GO:0048856	0.617	anatomical structure development
GO:0050896	0.499	response to stimulus
GO:0032501	0.310	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005576	0.999	extracellular region
GO:0043227	0.999	membrane-bounded organelle
GO:0005856	0.995	cytoskeleton
GO:0005829	0.994	cytosol
GO:1903561	0.987	extracellular vesicle
GO:0045111	0.978	intermediate filament cytoskeleton
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0005615	0.921	extracellular space
GO:0070062	0.870	extracellular exosome
GO:0005634	0.847	nucleus
GO:0016020	0.781	membrane
GO:0071944	0.676	cell periphery
GO:0099512	0.612	supramolecular fiber
GO:0005886	0.612	plasma membrane
GO:0099513	0.537	polymeric cytoskeletal fiber
GO:0005882	0.509	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]