StarFunc result for job id P08779

User Input

>input (473 residues)
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGG
ACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGAGFGGGFAGGDGLLVGSEKVT
MQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIA
ATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQ
IEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN
RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENS
LEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRL
LEGEDAHLSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08779	1.000	1.000	2.545E-63	473	1.000	1.000	P08779.pdb.gz	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
2	AFDB:Q9Z2K1	0.550	0.555	3.860E-49	469	0.839	0.846	Q9Z2K1.pdb.gz	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
3	AFDB:P02533	0.554	0.555	4.082E-48	472	0.837	0.839	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
4	AFDB:Q6IFV1	0.434	0.425	2.311E-45	485	0.776	0.757	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
5	AFDB:Q6PVZ1	0.568	0.574	4.947E-38	467	0.647	0.655	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
6	AFDB:Q6IFU8	0.512	0.553	7.564E-37	433	0.647	0.707	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
7	AFDB:P19012	0.622	0.642	1.245E-35	456	0.630	0.654	P19012.pdb.gz	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
8	AFDB:A1A4E9	0.459	0.472	9.109E-35	458	0.598	0.618	A1A4E9.pdb.gz	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
9	AFDB:Q61414	0.561	0.583	4.610E-34	452	0.613	0.642	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
10	AFDB:Q6IFV4	0.482	0.515	4.610E-34	438	0.596	0.644	Q6IFV4.pdb.gz	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
11	PDB:7utlV	0.084	0.198	4.630	170	0.078	0.218	7utlV.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
12	PDB:6u424R	0.169	0.209	5.365	366	0.114	0.148	6u424R.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
13	PDB:7c4jB	0.113	0.134	8.987	395	0.038	0.046	7c4jB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02533	0.0	588	472	0.619	0.621	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
2	P08779	0.0	946	473	1.000	1.000	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
3	Q04695	0.0	547	432	0.564	0.618	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
4	Q61781	0.0	569	484	0.567	0.554	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2
5	Q6IFU8	0.0	565	433	0.666	0.727	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
6	Q6IFV1	0.0	621	485	0.727	0.709	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
7	Q6PVZ1	0.0	516	467	0.636	0.645	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
8	Q9QWL7	0.0	562	433	0.664	0.725	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
9	Q9Z2K1	0.0	611	469	0.797	0.804	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
10	P19012	1.01e-173	497	456	0.507	0.526	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
11	Q6IFV3	2.16e-171	491	447	0.501	0.530	K1C15_RAT Keratin, type I cytoskeletal 15 OS=Rattus norvegicus OX=10116 GN=Krt15 PE=1 SV=1
12	P13646	9.72e-170	487	458	0.503	0.520	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
13	K7ERE3	2.86e-169	484	415	0.495	0.564	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
14	A1A4E9	6.48e-169	485	458	0.501	0.517	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
15	Q61414	1.83e-168	484	452	0.524	0.549	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
16	P19001	4.45e-168	481	403	0.490	0.576	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
17	Q63279	2.29e-165	474	403	0.478	0.561	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2
18	P08730	3.12e-165	475	437	0.488	0.529	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
19	P08727	1.10e-164	472	400	0.484	0.573	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
20	Q6IFV4	8.14e-164	471	438	0.484	0.523	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	5e-114	392.7	Intermediate filament protein
2	PF07926 TPR_MLP1_2	28	16.2	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301653

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252242	0.896	Keratin, type II cytoskeletal 5
2	9606.ENSP00000308452	0.786	Keratin, type I cytoskeletal 17
3	9606.ENSP00000269576	0.780	Keratin, type I cytoskeletal 10
4	9606.ENSP00000167586	0.771	Keratin, type I cytoskeletal 14
5	9606.ENSP00000252252	0.747	Keratin, type II cytoskeletal 6B
6	9606.ENSP00000206765	0.734	Protein-glutamine gamma-glutamyltransferase K
7	9606.ENSP00000357753	0.733	Involucrin
8	9606.ENSP00000306461	0.719	Cornifin-B
9	9606.ENSP00000369317	0.691	Keratin, type II cytoskeletal 6A
10	9606.ENSP00000357712	0.686	S100 calcium binding protein A7
11	9606.ENSP00000357789	0.665	Filaggrin
12	9606.ENSP00000379566	0.656	Coiled-coil alpha-helical rod protein 1
13	9606.ENSP00000002165	0.650	Plasma alpha-L-fucosidase
14	9606.ENSP00000357731	0.635	Loricrin
15	9606.ENSP00000357751	0.588	Cornifin-A
16	9606.ENSP00000343129	0.575	Tripartite motif-containing protein 29
17	9606.ENSP00000301263	0.574	Lymphocyte antigen 6D
18	9606.ENSP00000007735	0.565	Keratin, type I cuticular Ha3-I
19	9606.ENSP00000369129	0.558	Desmoplakin
20	9606.ENSP00000263946	0.551	Plakophilin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.976	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.990	developmental process
GO:0009987	0.988	cellular process
GO:0048856	0.984	anatomical structure development
GO:0009888	0.903	tissue development
GO:0008544	0.879	epidermis development
GO:0032501	0.791	multicellular organismal process
GO:0030855	0.767	epithelial cell differentiation
GO:0071840	0.749	cellular component organization or biogenesis
GO:0016043	0.738	cellular component organization
GO:0065007	0.685	biological regulation
GO:0045103	0.684	intermediate filament-based process
GO:0048513	0.684	animal organ development
GO:0050789	0.667	regulation of biological process
GO:0007010	0.596	cytoskeleton organization
GO:0050794	0.561	regulation of cellular process
GO:0043588	0.512	skin development
GO:0042303	0.477	molting cycle
GO:0050896	0.403	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005856	0.998	cytoskeleton
GO:0016020	0.992	membrane
GO:0045111	0.992	intermediate filament cytoskeleton
GO:0071944	0.986	cell periphery
GO:0043227	0.979	membrane-bounded organelle
GO:0005829	0.978	cytosol
GO:0005576	0.977	extracellular region
GO:0005886	0.976	plasma membrane
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0005882	0.965	intermediate filament
GO:0005634	0.934	nucleus
GO:0031982	0.871	vesicle
GO:0005615	0.867	extracellular space
GO:0070062	0.860	extracellular exosome
GO:0001533	0.821	cornified envelope
GO:0045095	0.752	keratin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]