StarFunc result for job id P08887

User Input

>input (468 residues)
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08887	1.000	1.000	5.288E-82	468	1.000	1.000	P08887.pdb.gz	IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL6R PE=1 SV=1
2	AFDB:P22272	0.641	0.652	2.908E-51	460	0.541	0.550	P22272.pdb.gz	IL6RA_MOUSE Interleukin-6 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il6ra PE=1 SV=2
3	AFDB:Q64385	0.432	0.461	1.650E-27	432	0.256	0.278	Q64385.pdb.gz	I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
4	AFDB:Q14626	0.419	0.458	4.583E-27	422	0.250	0.277	Q14626.pdb.gz	I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL11RA PE=1 SV=2
5	AFDB:O88507	0.484	0.590	2.339E-25	372	0.203	0.255	O88507.pdb.gz	CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
6	AFDB:A4JYQ0	0.486	0.618	1.134E-23	357	0.179	0.235	A4JYQ0.pdb.gz	A4JYQ0_DANRE Ciliary neurotrophic factor receptor OS=Danio rerio OX=7955 GN=cb549 PE=2 SV=1
7	AFDB:Q9JM58	0.414	0.449	2.277E-19	425	0.169	0.186	Q9JM58.pdb.gz	CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus musculus OX=10090 GN=Crlf1 PE=1 SV=1
8	AFDB:Q9W213	0.191	0.079	8.920E-16	1395	0.152	0.051	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
9	PDB:5mj3A	0.345	0.485	1.265E-15	302	0.124	0.192	5mj3A.pdb.gz
10	AFDB:A0A0R4IRZ4	0.306	0.285	3.542E-15	509	0.162	0.149	A0A0R4IRZ4.pdb.gz
11	AFDB:Q9BWV1	0.177	0.092	9.346E-15	1114	0.165	0.069	Q9BWV1.pdb.gz	BOC_HUMAN Brother of CDO OS=Homo sapiens OX=9606 GN=BOC PE=1 SV=1
12	PDB:7u7nC	0.370	0.805	3.144E-13	200	0.098	0.230	7u7nC.pdb.gz
13	PDB:7z0lB	0.308	0.376	5.217E-12	370	0.088	0.111	7z0lB.pdb.gz
14	PDB:6pxvA	0.194	0.126	1.358E-8	823	0.090	0.051	6pxvA.pdb.gz
15	PDB:8eyyA	0.190	0.134	3.075E-8	775	0.109	0.066	8eyyA.pdb.gz
16	PDB:8dtlA	0.195	0.141	8.540E-8	741	0.090	0.057	8dtlA.pdb.gz
17	PDB:6pyhD	0.174	0.115	1.659E-7	798	0.077	0.045	6pyhD.pdb.gz
18	PDB:7q5zA	0.172	0.080	2.372E-7	1344	0.079	0.028	7q5zA.pdb.gz
19	PDB:5oj2B	0.341	0.249	1.043E-6	692	0.111	0.075	5oj2B.pdb.gz
20	PDB:1igaA	0.175	0.173	3.739E-6	475	0.098	0.097	1igaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08887	0.0	961	468	1.000	1.000	IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL6R PE=1 SV=1
2	P22273	2.96e-165	476	462	0.551	0.558	IL6RA_RAT Interleukin-6 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il6r PE=2 SV=2
3	P22272	2.19e-155	451	460	0.541	0.550	IL6RA_MOUSE Interleukin-6 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il6ra PE=1 SV=2
4	A4JYQ0	1.78e-26	112	357	0.179	0.235	A4JYQ0_DANRE Ciliary neurotrophic factor receptor OS=Danio rerio OX=7955 GN=cb549 PE=2 SV=1
5	Q14626	3.16e-26	112	422	0.274	0.303	I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL11RA PE=1 SV=2
6	Q64385	5.09e-26	112	432	0.274	0.296	I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
7	Q99MF4	8.52e-24	105	431	0.209	0.227	I11RA_RAT Interleukin-11 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il11ra1 PE=2 SV=1
8	O88507	1.78e-23	103	372	0.171	0.215	CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
9	Q08406	3.45e-23	102	372	0.171	0.215	CNTFR_RAT Ciliary neurotrophic factor receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Cntfr PE=2 SV=2
10	P26992	3.60e-22	100	372	0.167	0.210	CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CNTFR PE=1 SV=2
11	O75462	1.99e-09	61.6	422	0.135	0.149	CRLF1_HUMAN Cytokine receptor-like factor 1 OS=Homo sapiens OX=9606 GN=CRLF1 PE=1 SV=1
12	F1N4H8	2.05e-09	60.8	296	0.107	0.169	F1N4H8_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=3 SV=2
13	Q9JM58	2.44e-09	61.6	425	0.167	0.184	CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus musculus OX=10090 GN=Crlf1 PE=1 SV=1
14	P29460	3.02e-09	60.8	328	0.158	0.226	IL12B_HUMAN Interleukin-12 subunit beta OS=Homo sapiens OX=9606 GN=IL12B PE=1 SV=1
15	Q28172	3.29e-09	61.6	581	0.107	0.086	PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=1 SV=1
16	Q04594	3.53e-09	61.6	831	0.130	0.073	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1
17	P46282	5.97e-09	59.7	327	0.156	0.223	IL12B_BOVIN Interleukin-12 subunit beta OS=Bos taurus OX=9913 GN=IL12B PE=2 SV=1
18	Q2PBN9	8.83e-09	60.1	581	0.105	0.084	Q2PBN9_BOVIN Prolactin receptor (Fragment) OS=Bos taurus OX=9913 GN=prlr PE=3 SV=1
19	P68220	2.13e-08	58.2	327	0.158	0.226	IL12B_SHEEP Interleukin-12 subunit beta OS=Ovis aries OX=9940 GN=IL12B PE=1 SV=1
20	Q90374	6.37e-08	57.8	830	0.141	0.080	PRLR_COLLI Prolactin receptor OS=Columba livia OX=8932 GN=PRLR PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	6.2	18.6	Fibronectin type III domain
2	PF07679 I-set	1.4e+02	13.9	Immunoglobulin I-set domain
3	PF00047 ig	0.0038	28.7	Immunoglobulin domain
4	PF13895 Ig_2	0.75	21.5	Immunoglobulin domain
5	PF13927 Ig_3	0.019	26.8	Immunoglobulin domain
6	PF16681 Ig_5	1.7e+02	14.1	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
7	PF09240 IL6Ra-bind	3.5e-17	74.0	Interleukin-6 receptor alpha chain, binding
8	PF07686 V-set	1.3e+02	14.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357470

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385675	0.999	Interleukin-6
2	9606.ENSP00000370698	0.994	Interleukin-6 receptor subunit beta
3	9606.ENSP00000264657	0.986	Signal transducer and activator of transcription 3
4	9606.ENSP00000343204	0.967	Tyrosine-protein kinase JAK1
5	9606.ENSP00000330341	0.958	Suppressor of cytokine signaling 3
6	9606.ENSP00000371067	0.958	Tyrosine-protein kinase JAK2
7	9606.ENSP00000365435	0.956	Tumor necrosis factor receptor superfamily member 1B
8	9606.ENSP00000321345	0.953	Interleukin-23 receptor
9	9606.ENSP00000431885	0.951	Non-receptor tyrosine-protein kinase TYK2
10	9606.ENSP00000354394	0.950	Signal transducer and activator of transcription 1-alpha/beta
11	9606.ENSP00000269571	0.948	Receptor tyrosine-protein kinase erbB-2
12	9606.ENSP00000264832	0.946	Intercellular adhesion molecule 1
13	9606.ENSP00000391676	0.940	Tyrosine-protein kinase JAK3
14	9606.ENSP00000263025	0.931	Mitogen-activated protein kinase 3
15	9606.ENSP00000340944	0.931	Tyrosine-protein phosphatase non-receptor type 11
16	9606.ENSP00000355370	0.928	Ciliary neurotrophic factor
17	9606.ENSP00000305416	0.924	Sphingosine 1-phosphate receptor 1
18	9606.ENSP00000427514	0.919	CCAAT/enhancer-binding protein alpha
19	9606.ENSP00000368880	0.917	Forkhead box protein O1
20	9606.ENSP00000484824	0.916	Mucin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004896	1.000	cytokine receptor activity
GO:0042802	0.998	identical protein binding
GO:0005126	0.998	cytokine receptor binding
GO:0046983	0.995	protein dimerization activity
GO:0070851	0.992	growth factor receptor binding
GO:0042803	0.984	protein homodimerization activity
GO:0019955	0.973	cytokine binding
GO:0019899	0.935	enzyme binding
GO:0019838	0.856	growth factor binding
GO:0004897	0.612	ciliary neurotrophic factor receptor activity
GO:0004915	0.580	interleukin-6 receptor activity
GO:0019981	0.317	interleukin-6 binding
GO:0070119	0.316	ciliary neurotrophic factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.996	cellular process
GO:0023052	0.991	signaling
GO:0007154	0.986	cell communication
GO:0051716	0.985	cellular response to stimulus
GO:0007165	0.983	signal transduction
GO:0042221	0.977	response to chemical
GO:0048518	0.969	positive regulation of biological process
GO:0019222	0.967	regulation of metabolic process
GO:0048583	0.965	regulation of response to stimulus
GO:0010033	0.964	response to organic substance
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0042127	0.961	regulation of cell population proliferation
GO:0048522	0.961	positive regulation of cellular process
GO:0019221	0.941	cytokine-mediated signaling pathway
GO:0008284	0.934	positive regulation of cell population proliferation
GO:0032502	0.924	developmental process
GO:0009893	0.920	positive regulation of metabolic process
GO:0010604	0.891	positive regulation of macromolecule metabolic process
GO:0051171	0.889	regulation of nitrogen compound metabolic process
GO:0080090	0.888	regulation of primary metabolic process
GO:0031323	0.887	regulation of cellular metabolic process
GO:0002376	0.883	immune system process
GO:0032501	0.848	multicellular organismal process
GO:0048856	0.843	anatomical structure development
GO:0048584	0.839	positive regulation of response to stimulus
GO:0006955	0.781	immune response
GO:0048519	0.780	negative regulation of biological process
GO:0051239	0.775	regulation of multicellular organismal process
GO:0031401	0.770	positive regulation of protein modification process
GO:0010468	0.765	regulation of gene expression
GO:0001932	0.761	regulation of protein phosphorylation
GO:0051240	0.746	positive regulation of multicellular organismal process
GO:0001934	0.735	positive regulation of protein phosphorylation
GO:0009966	0.716	regulation of signal transduction
GO:0010647	0.710	positive regulation of cell communication
GO:0023056	0.709	positive regulation of signaling
GO:0050730	0.699	regulation of peptidyl-tyrosine phosphorylation
GO:0009967	0.697	positive regulation of signal transduction
GO:0009605	0.690	response to external stimulus
GO:0050793	0.666	regulation of developmental process
GO:0006950	0.660	response to stress
GO:0030155	0.633	regulation of cell adhesion
GO:0002682	0.620	regulation of immune system process
GO:0044093	0.598	positive regulation of molecular function
GO:0001817	0.588	regulation of cytokine production
GO:0006952	0.585	defense response
GO:0010628	0.566	positive regulation of gene expression
GO:0050790	0.559	regulation of catalytic activity
GO:0002684	0.556	positive regulation of immune system process
GO:0045595	0.547	regulation of cell differentiation
GO:0051094	0.530	positive regulation of developmental process
GO:0050865	0.525	regulation of cell activation
GO:0009889	0.510	regulation of biosynthetic process
GO:0001819	0.506	positive regulation of cytokine production
GO:0050731	0.481	positive regulation of peptidyl-tyrosine phosphorylation
GO:0043207	0.466	response to external biotic stimulus
GO:0032101	0.466	regulation of response to external stimulus
GO:0044419	0.458	biological process involved in interspecies interaction between organisms
GO:0022407	0.434	regulation of cell-cell adhesion
GO:0051707	0.433	response to other organism
GO:0045785	0.429	positive regulation of cell adhesion
GO:1902531	0.417	regulation of intracellular signal transduction
GO:0051338	0.369	regulation of transferase activity
GO:0043085	0.367	positive regulation of catalytic activity
GO:0043549	0.355	regulation of kinase activity
GO:0022409	0.354	positive regulation of cell-cell adhesion
GO:0045859	0.348	regulation of protein kinase activity
GO:0042509	0.347	regulation of tyrosine phosphorylation of STAT protein
GO:0051347	0.333	positive regulation of transferase activity
GO:0042531	0.313	positive regulation of tyrosine phosphorylation of STAT protein
GO:0048523	0.300	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.999	extracellular region
GO:0032991	0.996	protein-containing complex
GO:0005615	0.975	extracellular space
GO:0043235	0.911	receptor complex
GO:0098797	0.900	plasma membrane protein complex
GO:0005622	0.893	intracellular anatomical structure
GO:0098802	0.871	plasma membrane signaling receptor complex
GO:0098590	0.742	plasma membrane region
GO:0043231	0.722	intracellular membrane-bounded organelle
GO:0005737	0.608	cytoplasm
GO:0045177	0.596	apical part of cell
GO:0005896	0.444	interleukin-6 receptor complex
GO:0070110	0.360	ciliary neurotrophic factor receptor complex
GO:0016324	0.331	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]