StarFunc result for job id P08913

User Input

>input (465 residues)
MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLML
LTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAW
CEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVIS
FPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKR
RTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGP
RDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTP
AAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPR
TLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08913	1.000	1.000	7.951E-55	465	1.000	1.000	P08913.pdb.gz	ADA2A_HUMAN Alpha-2A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2A PE=1 SV=4
2	AFDB:A0A060YRM0	0.621	0.727	3.827E-34	395	0.574	0.676	A0A060YRM0.pdb.gz	A0A060YRM0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023164001 PE=3 SV=1
3	AFDB:A0A060W139	0.642	0.760	8.295E-34	390	0.551	0.656	A0A060W139.pdb.gz	A0A060W139_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077426001 PE=3 SV=1
4	AFDB:Q90WY4	0.663	0.789	1.356E-32	388	0.548	0.657	Q90WY4.pdb.gz	ADA2A_DANRE Alpha-2A adrenergic receptor OS=Danio rerio OX=7955 GN=adra2a PE=3 SV=1
5	AFDB:Q90WY6	0.664	0.713	9.790E-32	432	0.527	0.567	Q90WY6.pdb.gz	ADA2C_DANRE Alpha-2C adrenergic receptor OS=Danio rerio OX=7955 GN=adra2c PE=3 SV=1
6	AFDB:Q90WY5	0.638	0.583	6.773E-31	510	0.520	0.475	Q90WY5.pdb.gz	ADA2B_DANRE Alpha-2B adrenergic receptor OS=Danio rerio OX=7955 GN=adra2b PE=3 SV=1
7	AFDB:P18089	0.631	0.652	1.744E-30	450	0.501	0.518	P18089.pdb.gz	ADA2B_HUMAN Alpha-2B adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2B PE=1 SV=4
8	AFDB:Q8JG69	0.628	0.701	2.920E-30	415	0.484	0.542	Q8JG69.pdb.gz	AA2DB_DANRE Alpha-2Db adrenergic receptor OS=Danio rerio OX=7955 GN=adra2db PE=3 SV=1
9	AFDB:A0A060YLN9	0.636	0.775	3.780E-30	380	0.482	0.589	A0A060YLN9.pdb.gz	A0A060YLN9_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00008424001 PE=3 SV=1
10	AFDB:A0A060YPY0	0.604	0.718	6.899E-30	384	0.473	0.573	A0A060YPY0.pdb.gz	A0A060YPY0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028829001 PE=3 SV=1
11	PDB:7ejaR	0.536	0.904	1.417E-23	269	0.576	0.996	7ejaR.pdb.gz	Structural insights into ligand recognition, activation, and signaling of the alpha 2A adrenergic receptor.
12	PDB:7e32R	0.538	0.855	1.612E-16	285	0.245	0.400	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	PDB:7jvqR	0.519	0.822	3.409E-15	286	0.241	0.392	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
14	PDB:7e2xR	0.518	0.846	9.162E-15	278	0.245	0.410	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
15	PDB:7f61A	0.575	0.868	9.984E-15	301	0.215	0.332	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
16	PDB:6iblA	0.524	0.610	2.924E-14	397	0.249	0.292	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
17	PDB:6g79S	0.521	0.903	3.186E-14	262	0.232	0.412	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
18	PDB:3pblA	0.525	0.564	3.326E-14	432	0.288	0.310	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.
19	PDB:7xt8R	0.518	0.795	3.950E-14	294	0.234	0.371	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
20	PDB:7cmuR	0.514	0.857	7.527E-14	272	0.256	0.438	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060YRM0	0.0	517	395	0.585	0.689	A0A060YRM0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023164001 PE=3 SV=1
2	P08913	0.0	940	465	1.000	1.000	ADA2A_HUMAN Alpha-2A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2A PE=1 SV=4
3	P18871	0.0	847	465	0.942	0.942	ADA2A_PIG Alpha-2A adrenergic receptor OS=Sus scrofa OX=9823 GN=ADRA2A PE=1 SV=2
4	P22909	0.0	848	465	0.912	0.912	ADA2A_RAT Alpha-2A adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2a PE=1 SV=3
5	Q01338	0.0	828	465	0.925	0.925	ADA2A_MOUSE Alpha-2A adrenergic receptor OS=Mus musculus OX=10090 GN=Adra2a PE=1 SV=2
6	A0A060W139	7.84e-173	492	390	0.557	0.664	A0A060W139_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077426001 PE=3 SV=1
7	A0A060W6G8	1.01e-172	492	390	0.551	0.656	A0A060W6G8_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00082532001 PE=3 SV=1
8	Q90WY4	1.82e-164	471	388	0.548	0.657	ADA2A_DANRE Alpha-2A adrenergic receptor OS=Danio rerio OX=7955 GN=adra2a PE=3 SV=1
9	Q90WY6	6.82e-156	451	432	0.525	0.565	ADA2C_DANRE Alpha-2C adrenergic receptor OS=Danio rerio OX=7955 GN=adra2c PE=3 SV=1
10	A0A060YLN9	4.74e-148	429	380	0.508	0.621	A0A060YLN9_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00008424001 PE=3 SV=1
11	Q90WY5	1.30e-142	420	510	0.523	0.476	ADA2B_DANRE Alpha-2B adrenergic receptor OS=Danio rerio OX=7955 GN=adra2b PE=3 SV=1
12	Q01337	6.84e-142	416	458	0.488	0.496	ADA2C_MOUSE Alpha-2C adrenergic receptor OS=Mus musculus OX=10090 GN=Adra2c PE=3 SV=1
13	P22086	6.99e-142	416	458	0.488	0.496	ADA2C_RAT Alpha-2C adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2c PE=2 SV=2
14	P30545	2.38e-141	414	453	0.512	0.525	ADA2B_MOUSE Alpha-2B adrenergic receptor OS=Mus musculus OX=10090 GN=Adra2b PE=1 SV=3
15	A0A060X9D7	3.55e-141	415	484	0.512	0.492	A0A060X9D7_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00051689001 PE=3 SV=1
16	P18089	3.42e-140	411	450	0.510	0.527	ADA2B_HUMAN Alpha-2B adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2B PE=1 SV=4
17	A0A060XV00	3.52e-140	413	489	0.499	0.474	A0A060XV00_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00044866001 PE=3 SV=1
18	P19328	5.59e-139	408	453	0.512	0.525	ADA2B_RAT Alpha-2B adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2b PE=1 SV=2
19	A0A060Y7B7	8.31e-139	409	475	0.480	0.469	A0A060Y7B7_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00056770001 PE=3 SV=1
20	A0A060YDW5	2.98e-137	404	446	0.473	0.493	A0A060YDW5_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00037859001 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	4.9e-70	247.4	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	5e-06	38.1	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	0.0011	30.0	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF04612 T2SSM	6.9e+02	11.8	Type II secretion system (T2SS), protein M

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280155

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316152	0.900	Pulmonary surfactant-associated protein C
2	9606.ENSP00000386346	0.900	Pulmonary surfactant-associated protein B
3	9606.ENSP00000478767	0.880	Neurabin-2
4	9606.ENSP00000312999	0.854	Guanine nucleotide-binding protein G(i) subunit alpha-2
5	9606.ENSP00000419361	0.822	Adenylate cyclase type 5
6	9606.ENSP00000229264	0.783	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
7	9606.ENSP00000284440	0.777	Ubiquitin carboxyl-terminal hydrolase isozyme L1
8	9606.ENSP00000286548	0.767	Guanine nucleotide-binding protein G(q) subunit alpha
9	9606.ENSP00000343027	0.767	Guanine nucleotide-binding protein G(i) subunit alpha-1
10	9606.ENSP00000481878	0.766	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
11	9606.ENSP00000478892	0.755	Guanine nucleotide-binding protein G(z) subunit alpha
12	9606.ENSP00000078429	0.738	Guanine nucleotide-binding protein subunit alpha-11
13	9606.ENSP00000378217	0.732	Protein kinase C delta type
14	9606.ENSP00000297323	0.730	Adenylate cyclase type 1
15	9606.ENSP00000312126	0.724	Adenylate cyclase type 4
16	9606.ENSP00000334448	0.714	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
17	9606.ENSP00000371594	0.710	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
18	9606.ENSP00000261837	0.700	Guanine nucleotide-binding protein subunit beta-5
19	9606.ENSP00000378187	0.698	Adenylate cyclase type 7
20	9606.ENSP00000297313	0.694	Regulator of G-protein signaling 20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004936	0.999	alpha-adrenergic receptor activity
GO:0005488	0.995	binding
GO:0005515	0.989	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007165	0.987	signal transduction
GO:0048519	0.968	negative regulation of biological process
GO:0007186	0.963	G protein-coupled receptor signaling pathway
GO:0048523	0.828	negative regulation of cellular process
GO:0051049	0.798	regulation of transport
GO:0051051	0.780	negative regulation of transport
GO:0090087	0.774	regulation of peptide transport
GO:0065008	0.768	regulation of biological quality
GO:0023051	0.768	regulation of signaling
GO:0010646	0.762	regulation of cell communication
GO:0050708	0.755	regulation of protein secretion
GO:1903828	0.567	negative regulation of protein localization
GO:0002791	0.515	regulation of peptide secretion
GO:0090276	0.514	regulation of peptide hormone secretion
GO:1904950	0.513	negative regulation of establishment of protein localization
GO:0032501	0.464	multicellular organismal process
GO:0050796	0.455	regulation of insulin secretion
GO:0051224	0.431	negative regulation of protein transport
GO:0065009	0.397	regulation of molecular function
GO:0046888	0.394	negative regulation of hormone secretion
GO:0048583	0.329	regulation of response to stimulus
GO:0007188	0.310	adenylate cyclase-modulating G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.795	intracellular anatomical structure
GO:0043226	0.778	organelle
GO:0005737	0.765	cytoplasm
GO:0043229	0.619	intracellular organelle
GO:0043227	0.494	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]