StarFunc result for job id P08922

User Input

>input (2347 residues)
MKNIYCLIPKLVNFATLGCLWISVVQCTVLNSCLKSCVTNLGQQLDLGTPHNLSEPCIQG
CHFWNSVDQKNCALKCRESCEVGCSSAEGAYEEEVLENADLPTAPFASSIGSHNMTLRWK
SANFSGVKYIIQWKYAQLLGSWTYTKTVSRPSYVVKPLHPFTEYIFRVVWIFTAQLQLYS
PPSPSYRTHPHGVPETAPLIRNIESSSPDTVEVSWDPPQFPGGPILGYNLRLISKNQKLD
AGTQRTSFQFYSTLPNTIYRFSIAAVNEVGEGPEAESSITTSSSAVQQEEQWLFLSRKTS
LRKRSLKHLVDEAHCLRLDAIYHNITGISVDVHQQIVYFSEGTLIWAKKAANMSDVSDLR
IFYRGSGLISSISIDWLYQRMYFIMDELVCVCDLENCSNIEEITPPSISAPQKIVADSYN
GYVFYLLRDGIYRADLPVPSGRCAEAVRIVESCTLKDFAIKPQAKRIIYFNDTAQVFMST
FLDGSASHLILPRIPFADVKSFACENNDFLVTDGKVIFQQDALSFNEFIVGCDLSHIEEF
GFGNLVIFGSSSQLHPLPGRPQELSVLFGSHQALVQWKPPALAIGANVILISDIIELFEL
GPSAWQNWTYEVKVSTQDPPEVTHIFLNISGTMLNVPELQSAMKYKVSVRASSPKRPGPW
SEPSVGTTLVPASEPPFIMAVKEDGLWSKPLNSFGPGEFLSSDIGNVSDMDWYNNSLYYS
DTKGDVFVWLLNGTDISENYHLPSIAGAGALAFEWLGHFLYWAGKTYVIQRQSVLTGHTD
IVTHVKLLVNDMVVDSVGGYLYWTTLYSVESTRLNGESSLVLQTQPWFSGKKVIALTLDL
SDGLLYWLVQDSQCIHLYTAVLRGQSTGDTTITEFAAWSTSEISQNALMYYSGRLFWING
FRIITTQEIGQKTSVSVLEPARFNQFTIIQTSLKPLPGNFSFTPKVIPDSVQESSFRIEG
NASSFQILWNGPPAVDWGVVFYSVEFSAHSKFLASEQHSLPVFTVEGLEPYALFNLSVTP
YTYWGKGPKTSLSLRAPETVPSAPENPRIFILPSGKCCNKNEVVVEFRWNKPKHENGVLT
KFEIFYNISNQSITNKTCEDWIAVNVTPSVMSFQLEGMSPRCFIAFQVRAFTSKGPGPYA
DVVKSTTSEINPFPHLITLLGNKIVFLDMDQNQVVWTFSAERVISAVCYTADNEMGYYAE
GDSLFLLHLHNRSSSELFQDSLVFDITVITIDWISRHLYFALKESQNGMQVFDVDLEHKV
KYPREVKIHNRNSTIISFSVYPLLSRLYWTEVSNFGYQMFYYSIISHTLHRILQPTATNQ
QNKRNQCSCNVTEFELSGAMAIDTSNLEKPLIYFAKAQEIWAMDLEGCQCWRVITVPAML
AGKTLVSLTVDGDLIYWIITAKDSTQIYQAKKGNGAIVSQVKALRSRHILAYSSVMQPFP
DKAFLSLASDTVEPTILNATNTSLTIRLPLAKTNLTWYGITSPTPTYLVYYAEVNDRKNS
SDLKYRILEFQDSIALIEDLQPFSTYMIQIAVKNYYSDPLEHLPPGKEIWGKTKNGVPEA
VQLINTTVRSDTSLIISWRESHKPNGPKESVRYQLAISHLALIPETPLRQSEFPNGRLTL
LVTRLSGGNIYVLKVLACHSEEMWCTESHPVTVEMFNTPEKPYSLVPENTSLQFNWKAPL
NVNLIRFWVELQKWKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENST
SLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGCRITYYILEIRKSTSNNLQNQN
LRWKMTFNGSCSSVCTWKSKNLKGIFQFRVVAANNLGFGEYSGISENIILVGDDFWIPET
SFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLAN
ACYAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVK
TLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRK
ARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKI
GDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQ
PYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRN
FFLNSIYKSRDEANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNREGLNYMVLATE
CGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGLNYACLTHS
GYGDGSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08922	1.000	1.000	0.000	2347	1.000	1.000	P08922.pdb.gz	ROS1_HUMAN Proto-oncogene tyrosine-protein kinase ROS OS=Homo sapiens OX=9606 GN=ROS1 PE=1 SV=3
2	AFDB:P13368	0.353	0.326	0.000	2554	0.233	0.214	P13368.pdb.gz	7LESS_DROME Protein sevenless OS=Drosophila melanogaster OX=7227 GN=sev PE=1 SV=2
3	AFDB:Q78DX7	0.505	0.506	0.000	2340	0.789	0.791	Q78DX7.pdb.gz	ROS1_MOUSE Proto-oncogene tyrosine-protein kinase ROS OS=Mus musculus OX=10090 GN=Ros1 PE=1 SV=1
4	AFDB:Q9UMZ3	0.110	0.110	5.266E-52	2332	0.123	0.123	Q9UMZ3.pdb.gz	PTPRQ_HUMAN Phosphatidylinositol phosphatase PTPRQ OS=Homo sapiens OX=9606 GN=PTPRQ PE=1 SV=2
5	AFDB:E9PSX9	0.117	0.305	2.851E-43	879	0.089	0.238	E9PSX9.pdb.gz	E9PSX9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
6	AFDB:E9PSY0	0.121	0.306	1.314E-42	888	0.093	0.245	E9PSY0.pdb.gz	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
7	AFDB:P30530	0.117	0.302	2.020E-42	894	0.089	0.233	P30530.pdb.gz	UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL PE=1 SV=4
8	AFDB:P55144	0.122	0.317	3.417E-42	880	0.093	0.249	P55144.pdb.gz	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
9	AFDB:Q00993	0.122	0.309	5.007E-42	888	0.090	0.239	Q00993.pdb.gz	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
10	AFDB:Q02763	0.117	0.242	1.560E-40	1124	0.091	0.190	Q02763.pdb.gz	TIE2_HUMAN Angiopoietin-1 receptor OS=Homo sapiens OX=9606 GN=TEK PE=1 SV=2
11	PDB:1k9aB	0.108	0.557	2.709E-19	441	0.054	0.286	1k9aB.pdb.gz
12	PDB:2h8hA	0.106	0.522	1.082E-18	445	0.058	0.306	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:6jp6A	0.103	0.209	2.438E-18	998	0.046	0.108	6jp6A.pdb.gz
14	PDB:4k2rA	0.104	0.420	8.048E-18	551	0.042	0.178	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:4fl2A	0.107	0.429	1.022E-17	555	0.042	0.177	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
16	PDB:6lqsB1	0.090	0.238	7.815E-15	806	0.029	0.086	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
17	PDB:5a42A	0.079	0.105	1.373E-13	1597	0.058	0.086	5a42A.pdb.gz
18	PDB:7ajtUA	0.091	0.232	1.918E-13	834	0.029	0.080	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:1nr0A	0.056	0.185	3.243E-13	610	0.035	0.136	1nr0A.pdb.gz
20	PDB:8dksA	0.095	0.694	3.568E-13	283	0.030	0.251	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08922	0.0	4870	2347	1.000	1.000	ROS1_HUMAN Proto-oncogene tyrosine-protein kinase ROS OS=Homo sapiens OX=9606 GN=ROS1 PE=1 SV=3
2	Q78DX7	0.0	3876	2340	0.798	0.801	ROS1_MOUSE Proto-oncogene tyrosine-protein kinase ROS OS=Mus musculus OX=10090 GN=Ros1 PE=1 SV=1
3	P13368	1.71e-92	339	2554	0.092	0.084	7LESS_DROME Protein sevenless OS=Drosophila melanogaster OX=7227 GN=sev PE=1 SV=2
4	F1LRZ0	2.87e-86	317	1617	0.075	0.109	F1LRZ0_RAT Tyrosine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Alk PE=3 SV=4
5	Q8SWV4	6.41e-86	310	1158	0.066	0.135	Q8SWV4_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
6	P97793	8.05e-86	315	1621	0.075	0.109	ALK_MOUSE ALK tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Alk PE=1 SV=2
7	Q9UM73	8.91e-85	311	1620	0.077	0.111	ALK_HUMAN ALK tyrosine kinase receptor OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=3
8	F8W3R9	1.77e-84	311	1705	0.062	0.085	ALK_DANRE ALK tyrosine kinase receptor OS=Danio rerio OX=7955 GN=alk PE=2 SV=2
9	Q7KJ08	3.08e-84	310	1701	0.066	0.092	Q7KJ08_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
10	P29376	8.03e-84	298	864	0.060	0.163	LTK_HUMAN Leukocyte tyrosine kinase receptor OS=Homo sapiens OX=9606 GN=LTK PE=1 SV=3
11	P08923	1.12e-83	298	888	0.058	0.153	LTK_MOUSE Leukocyte tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Ltk PE=1 SV=3
12	Q05688	1.07e-78	277	640	0.067	0.247	IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus OX=9913 GN=IGF1R PE=2 SV=1
13	F1QVU0	2.34e-78	291	1530	0.063	0.097	LTK_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ltk PE=1 SV=1
14	Q8CJH1	1.41e-77	263	351	0.061	0.405	Q8CJH1_RAT Tyrosine-protein kinase receptor (Fragment) OS=Rattus norvegicus OX=10116 GN=Alk PE=2 SV=1
15	Q1LVG4	5.40e-77	285	1348	0.080	0.139	Q1LVG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRb PE=1 SV=3
16	Q9PWN6	5.16e-76	277	989	0.060	0.142	Q9PWN6_CHICK Tyrosine-protein kinase receptor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
17	O73798	7.74e-76	281	1358	0.084	0.145	IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1
18	Q9PVZ4	1.84e-74	277	1362	0.060	0.104	INSR_XENLA Insulin receptor OS=Xenopus laevis OX=8355 GN=insr PE=1 SV=1
19	P08069	4.37e-74	276	1367	0.068	0.117	IGF1R_HUMAN Insulin-like growth factor 1 receptor OS=Homo sapiens OX=9606 GN=IGF1R PE=1 SV=1
20	G1K218	8.05e-74	275	1367	0.067	0.116	G1K218_BOVIN Tyrosine-protein kinase receptor OS=Bos taurus OX=9913 GN=IGF1R PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	1.9e-44	161.2	Fibronectin type III domain
2	PF00069 Pkinase	2.2e-35	133.9	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	1.6e-92	321.0	Protein tyrosine and serine/threonine kinase
4	PF16656 Pur_ac_phosph_N	0.3	23.1	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357494

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352717	0.909	Olfactory receptor 13G1
2	9606.ENSP00000424040	0.909	Taste receptor type 2 member 50
3	9606.ENSP00000320663	0.868	Echinoderm microtubule-associated protein-like 4
4	9606.ENSP00000009530	0.866	HLA class II histocompatibility antigen gamma chain
5	9606.ENSP00000256078	0.843	GTPase KRas
6	9606.ENSP00000407586	0.841	GTPase HRas
7	9606.ENSP00000425556	0.818	Palladin
8	9606.ENSP00000371483	0.787	Sodium-dependent phosphate transport protein 2B
9	9606.ENSP00000357474	0.747	Centrosomal protein 85 like
10	9606.ENSP00000263967	0.732	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
11	9606.ENSP00000351015	0.710	Neurofibromin
12	9606.ENSP00000307078	0.709	Kinesin-1 heavy chain
13	9606.ENSP00000263102	0.707	Coiled-coil domain containing 6
14	9606.ENSP00000357516	0.705	Tropomyosin alpha-3 chain
15	9606.ENSP00000376345	0.705	Growth factor receptor-bound protein 2
16	9606.ENSP00000357484	0.695	Golgi-associated PDZ and coiled-coil motif-containing protein
17	9606.ENSP00000370989	0.681	Programmed cell death 1 ligand 1
18	9606.ENSP00000361818	0.680	Syndecan-4
19	9606.ENSP00000326759	0.678	Leucine-rich repeats and immunoglobulin-like domains protein 3
20	9606.ENSP00000353401	0.667	Homeobox protein cut-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019903	1.000	protein phosphatase binding
GO:0004713	1.000	protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.993	cellular process
GO:1901564	0.990	organonitrogen compound metabolic process
GO:0048583	0.978	regulation of response to stimulus
GO:0023051	0.974	regulation of signaling
GO:0010646	0.965	regulation of cell communication
GO:1902531	0.949	regulation of intracellular signal transduction
GO:0006468	0.949	protein phosphorylation
GO:0051128	0.895	regulation of cellular component organization
GO:0050896	0.884	response to stimulus
GO:0048518	0.712	positive regulation of biological process
GO:0032501	0.677	multicellular organismal process
GO:0032502	0.674	developmental process
GO:0051716	0.643	cellular response to stimulus
GO:0048522	0.641	positive regulation of cellular process
GO:0048856	0.625	anatomical structure development
GO:0019222	0.619	regulation of metabolic process
GO:0048519	0.554	negative regulation of biological process
GO:0060255	0.480	regulation of macromolecule metabolic process
GO:0023052	0.466	signaling
GO:0007154	0.466	cell communication
GO:0031323	0.398	regulation of cellular metabolic process
GO:0007165	0.393	signal transduction
GO:0051171	0.350	regulation of nitrogen compound metabolic process
GO:0048523	0.348	negative regulation of cellular process
GO:0043408	0.347	regulation of MAPK cascade
GO:0010468	0.345	regulation of gene expression
GO:0080090	0.341	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0016020	0.989	membrane
GO:0071944	0.927	cell periphery
GO:0005886	0.914	plasma membrane
GO:0043229	0.826	intracellular organelle
GO:0043227	0.803	membrane-bounded organelle
GO:0043231	0.786	intracellular membrane-bounded organelle
GO:0009986	0.475	cell surface
GO:0005829	0.367	cytosol
GO:0048471	0.344	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]

[back to server]