StarFunc result for job id P08F94

User Input

>input (1400 residues)
MTAWLISLMSIEVLLLAVRHLSLHIEPEEGSLAGGTWITVIFDGLELGVLYPNNGSQLEI
HLVNVNMVVPALRSVPCDVFPVFLDLPVVTCRTRSVLSEAHEGLYFLEAYFGGQLVSSPN
PGPRDSCTFKFSKAQTPIVHQVYPPSGVPGKLIHVYGWIITGRLETFDFDAEYIDSPVIL
EAQGDKWVTPCSLINRQMGSCYPIQEDHGLGTLQCHVEGDYIGSQNVSFSVFNKGKSMVH
KKAWLISAKQDLFLYQTHSEILSVFPETGSLGGRTNITITGDFFDNSAQVTIAGIPCDIR
HVSPRKIECTTRAPGKDVRLTTPQPGNRGLLFEVGDAVEGLELTEATPGYRWQIVPNASS
PFGFWSQEGQPFRARLSGFFVAPETNNYTFWIQADSQASLHFSWSEEPRTKVKVASISVG
TADWFDSWEQNRDEGTWQQKTPKLELLGGAMYYLEAEHHGIAPSRGMRIGVQIHNTWLNP
DVVTTYLREKHQIRVRAQRLPEVQVLNVSGRGNFFLTWDNVSSQPIPANATAHLIQTTIE
ELLAVKCKLEPLWSNILLRLGFERGPEVSNSDGDLTSGTEPFCGRFSLRQPRHLVLTPPA
AQKGYRLDQYTHLCLAYKGHMNKILKMIVSFTIGFQNMVKNTTCDWSLTRTSPESWQFDC
TDLWETCVRCFGDLQPPPANSPVLVHQINLLPLAQETGLFYVDEIIIADTNVTVSQADSG
TARPGGNLVESVSVVGSPPVYSVTSWLAGCGTELPLITARSVPTEGTEEGSGLVLVTTQR
RQRTSPPLGGHFRIQLPNTVISDVPVQISAHHLHQLLQNNADDFTSRYLNASDFTVKEDL
YTCYEHVWTLSWSTQIGDLPNFIRVSDENLTGVNPAAATRVVYDGGVFLGPIFGDMLATA
NQHTQVVVRVNDVPAHCPGSCSFQYLQGSTPCVHSVWYSIDGDINLMIYITGTGFSGDSQ
FLQVTVNKTSCKVIFSNQTNVVCQTDLLPVGMHRILMLVRPSGLAISATGEDLFLNVKPR
LDMVEPSRAADIGGLWATIRGSSLEGVSLILFGSYSCAINVATSNSSRIQCKVPPRGKDG
RIVNVTVIRGDYSAVLPRAFTYVSSLNPVIVTLSRNISNIAGGETLVIGVARLMNYTDLD
VEVHVQDALAPVHTQSAWGLEVALPPLPAGLHRISVSINGVSIHSQGVDLHIQYLTEVFS
IEPCCGSLLGGTILSISGIGFSRDPALVWVLVGNRSCDIVNLTEASIWCETLPAPQIPDA
GAPTVPAAVEVWAGNRFFARGPSPSLVGKGFTFMYEAAATPVVTAMQGEITNSSLSLHVG
GSNLSNSVILLGNLNCDVETQSFQGNVSLSGCSIPLHSLEAGIYPLQVRQKQMGFANMSV
VLQQFAVMPRIMAIFPSQGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K2W1	0.617	0.540	0.000	1613	0.536	0.465	A0A0G2K2W1.pdb.gz	A0A0G2K2W1_RAT PKHD1 ciliary IPT domain containing fibrocystin/polyductin OS=Rattus norvegicus OX=10116 GN=Pkhd1 PE=1 SV=2
2	AFDB:Q54TD1	0.122	0.109	5.509E-23	1630	0.117	0.101	Q54TD1.pdb.gz	Q54TD1_DICDI IPT/TIG domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281853 PE=4 SV=1
3	AFDB:A0A2R8QPJ6	0.144	0.113	6.330E-23	1902	0.120	0.088	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
4	AFDB:Q9HCM2	0.139	0.110	1.693E-21	1894	0.124	0.092	Q9HCM2.pdb.gz	PLXA4_HUMAN Plexin-A4 OS=Homo sapiens OX=9606 GN=PLXNA4 PE=1 SV=4
5	AFDB:Q6BEA0	0.144	0.114	2.569E-21	1903	0.086	0.063	Q6BEA0.pdb.gz	PLXA4_DANRE Plexin-A4 OS=Danio rerio OX=7955 GN=plxna4 PE=2 SV=1
6	AFDB:Q3UH93	0.143	0.110	2.818E-21	1925	0.129	0.094	Q3UH93.pdb.gz	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
7	AFDB:Q9UIW2	0.148	0.117	2.818E-21	1896	0.114	0.084	Q9UIW2.pdb.gz	PLXA1_HUMAN Plexin-A1 OS=Homo sapiens OX=9606 GN=PLXNA1 PE=1 SV=3
8	AFDB:B0S5N4	0.146	0.115	1.183E-20	1892	0.114	0.085	B0S5N4.pdb.gz	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
9	AFDB:B2RXS4	0.146	0.118	2.600E-20	1842	0.124	0.094	B2RXS4.pdb.gz	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
10	AFDB:D3ZLH5	0.121	0.097	3.595E-20	1902	0.140	0.103	D3ZLH5.pdb.gz	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
11	PDB:1e07A	0.096	0.158	6.700E-12	642	0.065	0.142	1e07A.pdb.gz
12	PDB:6vxkB	0.109	0.179	5.199E-10	747	0.042	0.079	6vxkB.pdb.gz
13	PDB:5a42A	0.082	0.077	7.529E-10	1597	0.093	0.081	5a42A.pdb.gz
14	PDB:5e7gA	0.115	0.279	6.118E-8	446	0.047	0.148	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
15	PDB:4aq1A	0.079	0.117	6.408E-8	721	0.051	0.100	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
16	PDB:7sqcO0	0.097	0.110	7.362E-8	1140	0.071	0.088	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:5oj2B	0.087	0.134	9.280E-8	692	0.059	0.118	5oj2B.pdb.gz
18	PDB:4ziqA	0.064	0.062	1.637E-6	1450	0.076	0.073	4ziqA.pdb.gz
19	PDB:7vonA	0.070	0.070	2.370E-6	1399	0.086	0.086	7vonA.pdb.gz
20	PDB:7q5zA	0.081	0.084	5.454E-6	1344	0.057	0.060	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K2W1	0.0	1986	4052	0.706	0.244	A0A0G2K2W1_RAT PKHD1 ciliary IPT domain containing fibrocystin/polyductin OS=Rattus norvegicus OX=10116 GN=Pkhd1 PE=1 SV=2
2	E2RK30	0.0	2250	4074	0.778	0.267	PKHD1_CANLF Fibrocystin OS=Canis lupus familiaris OX=9615 GN=PKHD1 PE=3 SV=2
3	E9PZ36	0.0	2013	4059	0.721	0.249	PKHD1_MOUSE Fibrocystin OS=Mus musculus OX=10090 GN=Pkhd1 PE=1 SV=1
4	P08F94	0.0	2893	4074	1.000	0.344	PKHD1_HUMAN Fibrocystin OS=Homo sapiens OX=9606 GN=PKHD1 PE=1 SV=1
5	Q6T3A5	0.0	2012	4060	0.719	0.248	Q6T3A5_MOUSE PKHD1 OS=Mus musculus OX=10090 GN=Pkhd1 PE=2 SV=1
6	Q86WI1	3.46e-58	225	4243	0.144	0.048	PKHL1_HUMAN Fibrocystin-L OS=Homo sapiens OX=9606 GN=PKHD1L1 PE=2 SV=2
7	Q80ZA4	5.98e-55	214	4249	0.144	0.048	PKHL1_MOUSE Fibrocystin-L OS=Mus musculus OX=10090 GN=Pkhd1l1 PE=1 SV=1
8	Q6DSU3	0.003	44.7	1880	0.032	0.024	Q6DSU3_DANRE Plexin D1 OS=Danio rerio OX=7955 GN=zgc:77379 PE=1 SV=1
9	Q64GK4	0.006	43.5	1382	0.040	0.041	Q64GK4_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=cmet PE=2 SV=1
10	F1QLR7	0.010	42.7	1382	0.040	0.041	F1QLR7_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=c-met PE=4 SV=1
11	A8IYK2	0.039	41.2	1885	0.038	0.028	A8IYK2_DANRE Plexin-A1 OS=Danio rerio OX=7955 GN=plxna1 PE=1 SV=1
12	P70206	0.073	40.0	1894	0.036	0.026	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
13	F1Q7U0	0.086	40.0	2220	0.041	0.026	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
14	Q9Y4D7	0.31	38.1	1925	0.024	0.017	PLXD1_HUMAN Plexin-D1 OS=Homo sapiens OX=9606 GN=PLXND1 PE=1 SV=3
15	Q9UIW2	0.37	37.7	1896	0.036	0.026	PLXA1_HUMAN Plexin-A1 OS=Homo sapiens OX=9606 GN=PLXNA1 PE=1 SV=3
16	Q3UH93	0.42	37.7	1925	0.027	0.020	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
17	Q54IJ6	0.71	37.0	853	0.016	0.027	Q54IJ6_DICDI IPT/TIG domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=tgrM1 PE=4 SV=1
18	O15031	1.4	35.8	1838	0.029	0.022	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
19	Q9SZ91	1.7	35.0	322	0.014	0.062	Q9SZ91_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g09750 PE=1 SV=1
20	B2RXS4	1.8	35.4	1842	0.024	0.018	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10528 GLEYA	32	16.3	GLEYA domain
2	PF07691 PA14	78	14.5	PA14 domain
3	PF01833 TIG	1.6e-40	148.4	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360158

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000237596	0.981	Polycystin-2
2	9606.ENSP00000262304	0.936	Polycystin-1
3	9606.ENSP00000258526	0.764	Plexin-C1
4	9606.ENSP00000409171	0.764	Plexin-B2
5	9606.ENSP00000317128	0.740	Plexin-D1
6	9606.ENSP00000442736	0.739	Plexin-B3
7	9606.ENSP00000300935	0.700	Ras-related protein Rab-8A
8	9606.ENSP00000358696	0.674	Plexin-A3
9	9606.ENSP00000466134	0.672	Glucosidase 2 subunit beta
10	9606.ENSP00000377061	0.651	Plexin-A1
11	9606.ENSP00000352882	0.646	Plexin-A4
12	9606.ENSP00000356000	0.642	Plexin-A2
13	9606.ENSP00000351338	0.630	Plexin-B1
14	9606.ENSP00000297156	0.614	Calcium signal-modulating cyclophilin ligand
15	9606.ENSP00000262457	0.596	Inversin
16	9606.ENSP00000464443	0.583	Intraflagellar transport protein 20 homolog
17	9606.ENSP00000309031	0.549	Deubiquitinating protein VCIP135
18	9606.ENSP00000323580	0.528	Intraflagellar transport protein 88 homolog
19	9606.ENSP00000385808	0.518	Kinesin-like protein KIF3A
20	9606.ENSP00000480971	0.518	Somatostatin receptor type 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.899	regulation of cellular process
GO:0009987	0.872	cellular process
GO:0051179	0.668	localization
GO:0048522	0.638	positive regulation of cellular process
GO:0048856	0.631	anatomical structure development
GO:0048523	0.613	negative regulation of cellular process
GO:0032501	0.607	multicellular organismal process
GO:1902531	0.593	regulation of intracellular signal transduction
GO:0009888	0.529	tissue development
GO:0060429	0.517	epithelium development
GO:0009653	0.479	anatomical structure morphogenesis
GO:0050678	0.399	regulation of epithelial cell proliferation
GO:0010941	0.333	regulation of cell death
GO:0051726	0.330	regulation of cell cycle
GO:0043067	0.323	regulation of programmed cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0120025	0.997	plasma membrane bounded cell projection
GO:0043227	0.997	membrane-bounded organelle
GO:0005929	0.992	cilium
GO:0005622	0.973	intracellular anatomical structure
GO:0071944	0.905	cell periphery
GO:0005886	0.887	plasma membrane
GO:0043229	0.840	intracellular organelle
GO:0043232	0.767	intracellular non-membrane-bounded organelle
GO:0070062	0.740	extracellular exosome
GO:0005737	0.692	cytoplasm
GO:0098590	0.619	plasma membrane region
GO:0005856	0.427	cytoskeleton
GO:0015630	0.422	microtubule cytoskeleton
GO:0045177	0.406	apical part of cell
GO:0016324	0.382	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]