StarFunc result for job id P09016

User Input

>input (255 residues)
MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQ
PFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQ
PPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLT
RRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQH
LQPMAKDHHTDLTTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09016	1.000	1.000	1.067E-38	255	1.000	1.000	P09016.pdb.gz	HXD4_HUMAN Homeobox protein Hox-D4 OS=Homo sapiens OX=9606 GN=HOXD4 PE=1 SV=3
2	AFDB:O57374	0.455	0.488	4.538E-22	236	0.604	0.653	O57374.pdb.gz	HXD4A_DANRE Homeobox protein Hox-D4a OS=Danio rerio OX=7955 GN=hoxd4a PE=2 SV=2
3	AFDB:A0A024RB51	0.362	0.350	4.363E-20	264	0.569	0.549	A0A024RB51.pdb.gz
4	AFDB:P17483	0.477	0.483	1.138E-18	251	0.525	0.534	P17483.pdb.gz	HXB4_HUMAN Homeobox protein Hox-B4 OS=Homo sapiens OX=9606 GN=HOXB4 PE=1 SV=2
5	AFDB:P06798	0.343	0.308	2.657E-18	285	0.545	0.488	P06798.pdb.gz	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
6	AFDB:Q00056	0.359	0.294	5.340E-17	320	0.561	0.447	Q00056.pdb.gz	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
7	AFDB:P31268	0.286	0.316	2.473E-11	230	0.314	0.348	P31268.pdb.gz	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
8	AFDB:P09021	0.294	0.278	1.639E-10	270	0.376	0.356	P09021.pdb.gz	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
9	AFDB:Q8T940	0.279	0.281	4.361E-10	253	0.353	0.356	Q8T940.pdb.gz	UBX_JUNCO Homeotic protein ultrabithorax OS=Junonia coenia OX=39708 GN=Ubx PE=2 SV=1
10	AFDB:P09027	0.290	0.173	6.885E-10	433	0.345	0.203	P09027.pdb.gz	HXD3_MOUSE Homeobox protein Hox-D3 OS=Mus musculus OX=10090 GN=Hoxd3 PE=2 SV=4
11	PDB:2hi3A	0.212	0.638	2.395E-3	73	0.078	0.274	2hi3A.pdb.gz
12	PDB:4egcA	0.194	0.092	1.394E-2	539	0.051	0.024	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7fbyA	0.157	0.242	4.719E-1	153	0.031	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5nr5A	0.186	0.354	6.126E-1	113	0.071	0.159	5nr5A.pdb.gz
15	PDB:2cg4A	0.140	0.218	1.032	149	0.043	0.074	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:5z56L	0.166	0.127	1.740	342	0.047	0.035	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
17	PDB:6dv9F	0.116	0.160	1.740	174	0.031	0.046	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
18	PDB:2vbwA	0.133	0.206	2.573	147	0.043	0.075	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
19	PDB:5aj0BZ	0.160	0.407	2.573	86	0.039	0.116	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
20	PDB:7ml4M	0.160	0.172	2.746	234	0.027	0.030	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09016	0.0	524	255	1.000	1.000	HXD4_HUMAN Homeobox protein Hox-D4 OS=Homo sapiens OX=9606 GN=HOXD4 PE=1 SV=3
2	P10628	2.41e-143	403	250	0.875	0.892	HXD4_MOUSE Homeobox protein Hox-D4 OS=Mus musculus OX=10090 GN=Hoxd4 PE=1 SV=3
3	O57374	1.83e-100	294	236	0.604	0.653	HXD4A_DANRE Homeobox protein Hox-D4a OS=Danio rerio OX=7955 GN=hoxd4a PE=2 SV=2
4	Q08624	4.59e-79	241	264	0.565	0.545	HXC4_MOUSE Homeobox protein Hox-C4 OS=Mus musculus OX=10090 GN=Hoxc4 PE=2 SV=1
5	P09017	1.18e-77	237	264	0.569	0.549	HXC4_HUMAN Homeobox protein Hox-C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=2
6	Q86TF7	1.06e-76	234	264	0.565	0.545	Q86TF7_HUMAN Homeobox C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=1
7	P10284	2.07e-74	228	250	0.533	0.544	HXB4_MOUSE Homeobox protein Hox-B4 OS=Mus musculus OX=10090 GN=Hoxb4 PE=2 SV=1
8	P17483	1.27e-71	221	251	0.506	0.514	HXB4_HUMAN Homeobox protein Hox-B4 OS=Homo sapiens OX=9606 GN=HOXB4 PE=1 SV=2
9	P06798	2.00e-66	209	285	0.529	0.474	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
10	H0YHX3	1.73e-59	186	140	0.341	0.621	H0YHX3_HUMAN Homeobox A4 (Fragment) OS=Homo sapiens OX=9606 GN=HOXA4 PE=1 SV=1
11	Q00056	6.85e-58	188	320	0.376	0.300	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
12	P07548	1.30e-44	160	586	0.286	0.125	DFD_DROME Homeotic protein deformed OS=Drosophila melanogaster OX=7227 GN=Dfd PE=1 SV=2
13	P20719	3.02e-42	147	270	0.255	0.241	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
14	P09077	3.27e-42	150	417	0.271	0.165	SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster OX=7227 GN=Scr PE=1 SV=5
15	P09021	3.58e-42	146	270	0.255	0.241	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
16	P09013	1.52e-41	145	276	0.247	0.228	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
17	P09067	1.70e-41	145	269	0.247	0.234	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
18	P09079	1.94e-41	144	269	0.247	0.234	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
19	P09014	2.30e-41	144	275	0.247	0.229	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
20	P52949	2.23e-40	140	233	0.243	0.266	HXA5_RAT Homeobox protein Hox-A5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hoxa5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11040 DGF-1_C	2.6e+02	13.0	Dispersed gene family protein 1 of Trypanosoma cruzi C-terminus
2	PF09974 DUF2209	2.8e+02	13.2	Uncharacterized protein conserved in archaea (DUF2209)
3	PF05920 Homeobox_KN	4.7e+02	12.1	Homeobox KN domain
4	PF00046 Homeodomain	1.3e-18	77.8	Homeodomain
5	PF10500 SR-25	62	14.6	Nuclear RNA-splicing-associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302548

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243108	0.849	Homeobox protein Hox-C6
2	9606.ENSP00000239151	0.841	Homeobox protein Hox-B5
3	9606.ENSP00000309336	0.841	Homeobox protein Hox-C5
4	9606.ENSP00000242159	0.840	Homeobox protein Hox-A7
5	9606.ENSP00000420009	0.834	Homeobox protein Hox-B6
6	9606.ENSP00000239165	0.832	Homeobox protein Hox-B7
7	9606.ENSP00000222728	0.831	Homeobox protein Hox-A6
8	9606.ENSP00000399808	0.831	Homeobox protein Hox-C4
9	9606.ENSP00000222726	0.830	Homeobox protein Hox-A5
10	9606.ENSP00000328928	0.823	Homeobox protein Hox-B4
11	9606.ENSP00000476742	0.808	Uncharacterized protein
12	9606.ENSP00000386498	0.657	Homeobox protein Hox-D3
13	9606.ENSP00000405890	0.631	Pre-B-cell leukemia transcription factor 1
14	9606.ENSP00000249499	0.576	Homeobox protein Hox-D9
15	9606.ENSP00000224356	0.520	Cytochrome P450 26A1
16	9606.ENSP00000272369	0.520	Homeobox protein Meis1
17	9606.ENSP00000315949	0.519	Homeobox protein Hox-D8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.996	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.985	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.986	developmental process
GO:0050794	0.985	regulation of cellular process
GO:0048856	0.970	anatomical structure development
GO:0019222	0.964	regulation of metabolic process
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0080090	0.951	regulation of primary metabolic process
GO:0032501	0.946	multicellular organismal process
GO:0031323	0.945	regulation of cellular metabolic process
GO:0010468	0.943	regulation of gene expression
GO:0051171	0.941	regulation of nitrogen compound metabolic process
GO:0009889	0.936	regulation of biosynthetic process
GO:0006355	0.934	regulation of DNA-templated transcription
GO:0048731	0.882	system development
GO:0009653	0.834	anatomical structure morphogenesis
GO:0048568	0.815	embryonic organ development
GO:0006357	0.803	regulation of transcription by RNA polymerase II
GO:0048518	0.788	positive regulation of biological process
GO:0048522	0.746	positive regulation of cellular process
GO:0010604	0.744	positive regulation of macromolecule metabolic process
GO:0051173	0.716	positive regulation of nitrogen compound metabolic process
GO:0031325	0.716	positive regulation of cellular metabolic process
GO:0009887	0.713	animal organ morphogenesis
GO:0009952	0.695	anterior/posterior pattern specification
GO:0009891	0.648	positive regulation of biosynthetic process
GO:0051254	0.645	positive regulation of RNA metabolic process
GO:0031328	0.643	positive regulation of cellular biosynthetic process
GO:1902680	0.612	positive regulation of RNA biosynthetic process
GO:0009987	0.597	cellular process
GO:0045944	0.583	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]