StarFunc result for job id P09038

User Input

>input (288 residues)
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09038	0.999	0.999	1.021E-45	288	1.000	1.000	P09038.pdb.gz	FGF2_HUMAN Fibroblast growth factor 2 OS=Homo sapiens OX=9606 GN=FGF2 PE=1 SV=3
2	AFDB:P48800	0.462	0.834	7.234E-28	158	0.493	0.899	P48800.pdb.gz	FGF2_CHICK Fibroblast growth factor 2 OS=Gallus gallus OX=9031 GN=FGF2 PE=2 SV=1
3	AFDB:P12226	0.462	0.852	7.465E-27	155	0.451	0.839	P12226.pdb.gz	FGF2_XENLA Fibroblast growth factor 2 OS=Xenopus laevis OX=8355 GN=fgf2 PE=2 SV=2
4	AFDB:A0A060Y7E5	0.498	0.910	7.509E-25	155	0.406	0.755	A0A060Y7E5.pdb.gz	A0A060Y7E5_ONCMY Fibroblast growth factor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000746001 PE=3 SV=1
5	AFDB:A0A0R4IHF9	0.466	0.862	1.184E-24	154	0.399	0.747	A0A0R4IHF9.pdb.gz
6	AFDB:G1NDN4	0.433	0.836	2.798E-22	147	0.399	0.782	G1NDN4.pdb.gz	G1NDN4_MELGA Fibroblast growth factor OS=Meleagris gallopavo OX=9103 GN=FGF2 PE=3 SV=3
7	AFDB:P61148	0.453	0.836	5.899E-20	155	0.260	0.484	P61148.pdb.gz	FGF1_MOUSE Fibroblast growth factor 1 OS=Mus musculus OX=10090 GN=Fgf1 PE=1 SV=1
8	AFDB:P03968	0.453	0.833	9.847E-20	155	0.257	0.477	P03968.pdb.gz	FGF1_BOVIN Fibroblast growth factor 1 OS=Bos taurus OX=9913 GN=FGF1 PE=1 SV=2
9	AFDB:P19596	0.452	0.833	1.103E-19	155	0.257	0.477	P19596.pdb.gz	FGF1_CHICK Fibroblast growth factor 1 OS=Gallus gallus OX=9031 GN=FGF1 PE=1 SV=2
10	PDB:1ry7A	0.451	0.847	2.236E-17	151	0.264	0.503	1ry7A.pdb.gz
11	AFDB:P08620	0.428	0.596	1.082E-16	206	0.229	0.320	P08620.pdb.gz	FGF4_HUMAN Fibroblast growth factor 4 OS=Homo sapiens OX=9606 GN=FGF4 PE=1 SV=1
12	PDB:3f1rA	0.421	0.763	1.907E-13	157	0.170	0.312	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
13	PDB:4jq0A	0.403	0.805	9.941E-13	141	0.139	0.284	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
14	PDB:6b0tA	0.371	0.226	1.469E-5	487	0.076	0.045	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:4qd2B	0.371	0.697	8.107E-5	143	0.062	0.126	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
16	PDB:3malA	0.341	0.525	1.078E-4	181	0.069	0.110	3malA.pdb.gz
17	PDB:1hcdA	0.342	0.745	2.391E-4	118	0.059	0.144	1hcdA.pdb.gz
18	PDB:2d43A	0.364	0.224	3.365E-4	482	0.080	0.048	2d43A.pdb.gz	The family 42 carbohydrate-binding module of family 54 alpha-L-arabinofuranosidase specifically binds the arabinofuranose side chain of hemicellulose
19	PDB:3wmuB	0.359	0.641	3.562E-4	153	0.073	0.137	3wmuB.pdb.gz
20	PDB:1t9fA	0.363	0.566	3.991E-4	178	0.062	0.101	1t9fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09038	0.0	570	288	1.000	1.000	FGF2_HUMAN Fibroblast growth factor 2 OS=Homo sapiens OX=9606 GN=FGF2 PE=1 SV=3
2	P13109	3.50e-109	314	154	0.521	0.974	FGF2_RAT Fibroblast growth factor 2 OS=Rattus norvegicus OX=10116 GN=Fgf2 PE=1 SV=1
3	P15655	4.37e-107	309	154	0.510	0.955	FGF2_MOUSE Fibroblast growth factor 2 OS=Mus musculus OX=10090 GN=Fgf2 PE=1 SV=1
4	P48800	4.96e-102	296	158	0.493	0.899	FGF2_CHICK Fibroblast growth factor 2 OS=Gallus gallus OX=9031 GN=FGF2 PE=2 SV=1
5	P12226	4.18e-94	276	155	0.451	0.839	FGF2_XENLA Fibroblast growth factor 2 OS=Xenopus laevis OX=8355 GN=fgf2 PE=2 SV=2
6	A0A060Y7E5	7.79e-82	245	155	0.406	0.755	A0A060Y7E5_ONCMY Fibroblast growth factor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000746001 PE=3 SV=1
7	Q5FXK5	3.02e-81	244	155	0.406	0.755	Q5FXK5_ONCMY Fibroblast growth factor OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
8	B3DGE3	1.04e-80	242	154	0.403	0.753	B3DGE3_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf2 PE=2 SV=1
9	G1NDN4	8.19e-76	229	147	0.382	0.748	G1NDN4_MELGA Fibroblast growth factor OS=Meleagris gallopavo OX=9103 GN=FGF2 PE=3 SV=3
10	P19596	2.40e-50	165	155	0.292	0.542	FGF1_CHICK Fibroblast growth factor 1 OS=Gallus gallus OX=9031 GN=FGF1 PE=1 SV=2
11	P05230	1.15e-49	163	155	0.295	0.548	FGF1_HUMAN Fibroblast growth factor 1 OS=Homo sapiens OX=9606 GN=FGF1 PE=1 SV=1
12	P61148	1.80e-48	160	155	0.292	0.542	FGF1_MOUSE Fibroblast growth factor 1 OS=Mus musculus OX=10090 GN=Fgf1 PE=1 SV=1
13	P61149	1.80e-48	160	155	0.292	0.542	FGF1_RAT Fibroblast growth factor 1 OS=Rattus norvegicus OX=10116 GN=Fgf1 PE=1 SV=1
14	P03968	7.57e-48	159	155	0.285	0.529	FGF1_BOVIN Fibroblast growth factor 1 OS=Bos taurus OX=9913 GN=FGF1 PE=1 SV=2
15	Q6PBT8	4.29e-34	123	147	0.219	0.429	FGF1_DANRE Putative fibroblast growth factor 1 OS=Danio rerio OX=7955 GN=fgf1 PE=2 SV=1
16	Q8R5L5	3.78e-25	101	208	0.191	0.264	Q8R5L5_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf6 PE=2 SV=1
17	P21658	4.51e-25	101	208	0.191	0.264	FGF6_MOUSE Fibroblast growth factor 6 OS=Mus musculus OX=10090 GN=Fgf6 PE=2 SV=2
18	P10767	6.31e-25	100	208	0.191	0.264	FGF6_HUMAN Fibroblast growth factor 6 OS=Homo sapiens OX=9606 GN=FGF6 PE=1 SV=4
19	P08620	9.63e-25	100	206	0.222	0.311	FGF4_HUMAN Fibroblast growth factor 4 OS=Homo sapiens OX=9606 GN=FGF4 PE=1 SV=1
20	P48802	1.80e-24	100	256	0.191	0.215	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06268 Fascin	0.31	22.7	Fascin domain
2	PF00167 FGF	4.4e-39	144.8	Fibroblast growth factor
3	PF00340 IL1	2	19.5	Interleukin-1 / 18

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264498

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339824	0.999	Fibroblast growth factor receptor 3
2	9606.ENSP00000393312	0.999	Fibroblast growth factor receptor 1
3	9606.ENSP00000410294	0.999	Fibroblast growth factor receptor 2
4	9606.ENSP00000295927	0.997	Pentraxin-related protein PTX3
5	9606.ENSP00000361818	0.997	Syndecan-4
6	9606.ENSP00000363827	0.997	Basement membrane-specific heparan sulfate proteoglycan core protein
7	9606.ENSP00000370542	0.997	Syndecan-1
8	9606.ENSP00000398632	0.994	CD44 antigen
9	9606.ENSP00000264039	0.992	Glypican-1
10	9606.ENSP00000478570	0.991	Vascular endothelial growth factor A
11	9606.ENSP00000292408	0.989	Fibroblast growth factor receptor 4
12	9606.ENSP00000323588	0.985	Transcription factor SOX-2
13	9606.ENSP00000431418	0.984	High affinity nerve growth factor receptor
14	9606.ENSP00000259915	0.982	POU domain, class 5, transcription factor 1
15	9606.ENSP00000229307	0.981	Homeobox protein NANOG
16	9606.ENSP00000249075	0.981	Leukemia inhibitory factor
17	9606.ENSP00000262648	0.981	Anosmin-1
18	9606.ENSP00000221930	0.978	Transforming growth factor beta-1
19	9606.ENSP00000371770	0.978	Fibroblast growth factor-binding protein 1
20	9606.ENSP00000291700	0.977	Protein S100-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.996	growth factor activity
GO:0005104	0.995	fibroblast growth factor receptor binding
GO:0042056	0.991	chemoattractant activity
GO:0005125	0.948	cytokine activity
GO:0044877	0.886	protein-containing complex binding
GO:0140110	0.852	transcription regulator activity
GO:0042802	0.717	identical protein binding
GO:0003713	0.624	transcription coactivator activity
GO:0050839	0.600	cell adhesion molecule binding
GO:0005178	0.594	integrin binding
GO:0019955	0.590	cytokine binding
GO:0030374	0.579	nuclear receptor coactivator activity
GO:0097367	0.567	carbohydrate derivative binding
GO:1901681	0.558	sulfur compound binding
GO:0019956	0.498	chemokine binding
GO:0005539	0.442	glycosaminoglycan binding
GO:0008201	0.422	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.985	response to stimulus
GO:0032501	0.981	multicellular organismal process
GO:0007165	0.980	signal transduction
GO:0048856	0.978	anatomical structure development
GO:0008284	0.978	positive regulation of cell population proliferation
GO:0007166	0.974	cell surface receptor signaling pathway
GO:0051240	0.964	positive regulation of multicellular organismal process
GO:0009653	0.961	anatomical structure morphogenesis
GO:0051094	0.957	positive regulation of developmental process
GO:0070848	0.928	response to growth factor
GO:0007275	0.923	multicellular organism development
GO:0048519	0.917	negative regulation of biological process
GO:0031323	0.910	regulation of cellular metabolic process
GO:0071704	0.901	organic substance metabolic process
GO:0060255	0.901	regulation of macromolecule metabolic process
GO:0007169	0.900	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0051171	0.896	regulation of nitrogen compound metabolic process
GO:0048523	0.890	negative regulation of cellular process
GO:0071774	0.888	response to fibroblast growth factor
GO:0048731	0.878	system development
GO:0030335	0.877	positive regulation of cell migration
GO:0043410	0.875	positive regulation of MAPK cascade
GO:0042327	0.873	positive regulation of phosphorylation
GO:0071495	0.871	cellular response to endogenous stimulus
GO:0010604	0.859	positive regulation of macromolecule metabolic process
GO:0071363	0.852	cellular response to growth factor stimulus
GO:0009888	0.848	tissue development
GO:0022603	0.844	regulation of anatomical structure morphogenesis
GO:0001934	0.842	positive regulation of protein phosphorylation
GO:0010632	0.841	regulation of epithelial cell migration
GO:0048513	0.835	animal organ development
GO:0045765	0.824	regulation of angiogenesis
GO:0010594	0.821	regulation of endothelial cell migration
GO:0044093	0.820	positive regulation of molecular function
GO:0044237	0.805	cellular metabolic process
GO:0045766	0.802	positive regulation of angiogenesis
GO:0051338	0.794	regulation of transferase activity
GO:0048869	0.793	cellular developmental process
GO:0050678	0.788	regulation of epithelial cell proliferation
GO:0009605	0.766	response to external stimulus
GO:0070372	0.759	regulation of ERK1 and ERK2 cascade
GO:0070374	0.751	positive regulation of ERK1 and ERK2 cascade
GO:0045595	0.746	regulation of cell differentiation
GO:0050679	0.744	positive regulation of epithelial cell proliferation
GO:0016477	0.730	cell migration
GO:0051896	0.724	regulation of protein kinase B signaling
GO:0044344	0.719	cellular response to fibroblast growth factor stimulus
GO:0042221	0.714	response to chemical
GO:0001525	0.680	angiogenesis
GO:0008543	0.672	fibroblast growth factor receptor signaling pathway
GO:0009889	0.597	regulation of biosynthetic process
GO:0010556	0.584	regulation of macromolecule biosynthetic process
GO:0031326	0.584	regulation of cellular biosynthetic process
GO:0019219	0.580	regulation of nucleobase-containing compound metabolic process
GO:0006807	0.567	nitrogen compound metabolic process
GO:0030154	0.567	cell differentiation
GO:0001822	0.558	kidney development
GO:0060429	0.541	epithelium development
GO:0001823	0.531	mesonephros development
GO:0009887	0.529	animal organ morphogenesis
GO:0002009	0.527	morphogenesis of an epithelium
GO:0072006	0.522	nephron development
GO:0072073	0.522	kidney epithelium development
GO:0060562	0.521	epithelial tube morphogenesis
GO:0060993	0.516	kidney morphogenesis
GO:0045935	0.514	positive regulation of nucleobase-containing compound metabolic process
GO:0044238	0.513	primary metabolic process
GO:0060675	0.512	ureteric bud morphogenesis
GO:0010557	0.511	positive regulation of macromolecule biosynthetic process
GO:0031328	0.511	positive regulation of cellular biosynthetic process
GO:0010468	0.504	regulation of gene expression
GO:0006950	0.488	response to stress
GO:0043170	0.485	macromolecule metabolic process
GO:0051252	0.453	regulation of RNA metabolic process
GO:2001141	0.443	regulation of RNA biosynthetic process
GO:1903506	0.426	regulation of nucleic acid-templated transcription
GO:0006355	0.424	regulation of DNA-templated transcription
GO:0010941	0.320	regulation of cell death
GO:0045893	0.320	positive regulation of DNA-templated transcription
GO:0006357	0.309	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043227	0.333	membrane-bounded organelle
GO:0043229	0.328	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]