StarFunc result for job id P09067

User Input

>input (269 residues)
MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSS
ASSSHFGAVGESSRAFPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHGAKPSASSPSDQ
ATSASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWM
RKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKI
WFQNRRMKWKKDNKLKSMSLATAGSAFQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09067	1.000	1.000	8.539E-37	269	1.000	1.000	P09067.pdb.gz	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
2	AFDB:P09014	0.434	0.424	6.471E-27	275	0.773	0.756	P09014.pdb.gz	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
3	AFDB:P09013	0.368	0.361	3.992E-24	276	0.729	0.710	P09013.pdb.gz	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
4	AFDB:P09016	0.308	0.324	2.110E-10	255	0.353	0.373	P09016.pdb.gz	HXD4_HUMAN Homeobox protein Hox-D4 OS=Homo sapiens OX=9606 GN=HOXD4 PE=1 SV=3
5	AFDB:P09630	0.315	0.359	8.926E-10	235	0.286	0.328	P09630.pdb.gz	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
6	AFDB:Q9QX99	0.264	0.215	1.821E-8	333	0.234	0.189	Q9QX99.pdb.gz	Q9QX99_MOUSE T-cell leukemia, homeobox 1 OS=Mus musculus OX=10090 GN=Tlx1 PE=1 SV=1
7	AFDB:A8KBT9	0.286	0.285	2.882E-8	270	0.275	0.274	A8KBT9.pdb.gz	A8KBT9_DANRE Caudal type homeo box transcription factor 4 OS=Danio rerio OX=7955 GN=CHUNP6923 PE=2 SV=1
8	AFDB:Q9YGS6	0.276	0.285	4.560E-8	260	0.297	0.308	Q9YGS6.pdb.gz	HXC9A_DANRE Homeobox protein Hox-C9a OS=Danio rerio OX=7955 GN=hoxc9a PE=2 SV=2
9	AFDB:P83949	0.240	0.173	1.484E-7	389	0.297	0.206	P83949.pdb.gz	UBX_DROME Homeotic protein ultrabithorax OS=Drosophila melanogaster OX=7227 GN=Ubx PE=1 SV=1
10	AFDB:P28356	0.252	0.195	6.278E-7	352	0.297	0.227	P28356.pdb.gz	HXD9_HUMAN Homeobox protein Hox-D9 OS=Homo sapiens OX=9606 GN=HOXD9 PE=1 SV=5
11	PDB:4egcA	0.177	0.089	2.251E-2	539	0.052	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.191	0.621	6.019E-2	73	0.059	0.219	2hi3A.pdb.gz
13	PDB:7fbyA	0.139	0.228	1.077	153	0.026	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:4ldzA	0.178	0.238	1.943	196	0.030	0.041	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
15	PDB:1yioA	0.125	0.163	2.215	198	0.033	0.045	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
16	PDB:4d8jA	0.138	0.230	2.526	149	0.045	0.081	4d8jA.pdb.gz	Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
17	PDB:5aj0BZ	0.152	0.408	2.526	86	0.030	0.093	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
18	PDB:5nr5A	0.148	0.318	2.526	113	0.033	0.080	5nr5A.pdb.gz
19	PDB:5mrc66	0.165	0.149	2.880	305	0.037	0.033	5mrc66.pdb.gz	The structure of the yeast mitochondrial ribosome.
20	PDB:2cg4A	0.123	0.211	3.505	149	0.037	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09067	0.0	553	269	1.000	1.000	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
2	P09079	0.0	546	269	0.989	0.989	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
3	P09014	7.00e-141	399	275	0.773	0.756	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
4	P09013	5.17e-134	381	276	0.725	0.707	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
5	P20719	4.17e-100	295	270	0.625	0.622	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
6	P09021	3.01e-99	293	270	0.621	0.619	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
7	P52949	4.12e-74	228	233	0.502	0.579	HXA5_RAT Homeobox protein Hox-A5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hoxa5 PE=2 SV=1
8	P32043	2.00e-53	174	222	0.413	0.500	HXC5_MOUSE Homeobox protein Hox-C5 OS=Mus musculus OX=10090 GN=Hoxc5 PE=2 SV=3
9	Q00444	5.41e-52	171	222	0.405	0.491	HXC5_HUMAN Homeobox protein Hox-C5 OS=Homo sapiens OX=9606 GN=HOXC5 PE=1 SV=1
10	P06798	6.98e-45	154	285	0.253	0.239	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
11	P09077	1.71e-43	154	417	0.242	0.156	SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster OX=7227 GN=Scr PE=1 SV=5
12	H0YHX3	9.20e-43	144	140	0.238	0.457	H0YHX3_HUMAN Homeobox A4 (Fragment) OS=Homo sapiens OX=9606 GN=HOXA4 PE=1 SV=1
13	Q08624	9.78e-43	148	264	0.260	0.265	HXC4_MOUSE Homeobox protein Hox-C4 OS=Mus musculus OX=10090 GN=Hoxc4 PE=2 SV=1
14	P09017	1.01e-42	148	264	0.260	0.265	HXC4_HUMAN Homeobox protein Hox-C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=2
15	O57374	2.09e-42	146	236	0.245	0.280	HXD4A_DANRE Homeobox protein Hox-D4a OS=Danio rerio OX=7955 GN=hoxd4a PE=2 SV=2
16	Q86TF7	2.28e-42	147	264	0.260	0.265	Q86TF7_HUMAN Homeobox C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=1
17	Q00056	5.11e-42	148	320	0.238	0.200	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
18	P10284	7.12e-42	145	250	0.245	0.264	HXB4_MOUSE Homeobox protein Hox-B4 OS=Mus musculus OX=10090 GN=Hoxb4 PE=2 SV=1
19	P17483	1.07e-41	145	251	0.245	0.263	HXB4_HUMAN Homeobox protein Hox-B4 OS=Homo sapiens OX=9606 GN=HOXB4 PE=1 SV=2
20	P17509	4.85e-41	142	224	0.398	0.478	HXB6_HUMAN Homeobox protein Hox-B6 OS=Homo sapiens OX=9606 GN=HOXB6 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09974 DUF2209	2.8e+02	13.2	Uncharacterized protein conserved in archaea (DUF2209)
2	PF05339 DUF739	3.8e+02	12.6	Protein of unknown function (DUF739)
3	PF05920 Homeobox_KN	3.6e+02	12.5	Homeobox KN domain
4	PF00046 Homeodomain	1.3e-18	77.9	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010357917.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010357901.1	0.924	Homeobox protein Hox-B6
2	61622.XP_010386610.1	0.906	Homeobox protein Hox-A5
3	61622.XP_010372174.1	0.847	Homeobox protein Hox-C4
4	61622.XP_010372178.1	0.765	Homeobox C5
5	61622.XP_010357938.1	0.760	Homeobox protein Hox-B7
6	61622.XP_010380617.1	0.757	Homeobox protein Hox-D4
7	61622.XP_010357728.1	0.756	Homeobox protein Hox-B4
8	61622.XP_010386607.1	0.747	Homeobox A7
9	61622.XP_010372175.1	0.745	Homeobox protein Hox-C6 isoform X1
10	61622.XP_010386609.1	0.745	Homeobox protein Hox-A6
11	61622.XP_010372181.1	0.707	Homeobox protein Hox-C10
12	61622.XP_010357943.1	0.549	Homeobox protein Hox-B8 isoform X1
13	61622.XP_010371661.1	0.510	PBX homeobox 1
14	61622.XP_010373636.1	0.509	Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family
15	61622.XP_010372182.1	0.507	Homeobox protein Hox-C11 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.970	DNA-binding transcription factor activity
GO:0000981	0.948	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.946	transcription cis-regulatory region binding
GO:0000977	0.925	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.845	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.573	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.557	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.988	developmental process
GO:0050794	0.979	regulation of cellular process
GO:0007275	0.976	multicellular organism development
GO:0010604	0.961	positive regulation of macromolecule metabolic process
GO:0051173	0.940	positive regulation of nitrogen compound metabolic process
GO:0048731	0.938	system development
GO:0031325	0.924	positive regulation of cellular metabolic process
GO:0009891	0.908	positive regulation of biosynthetic process
GO:0019219	0.900	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.895	regulation of gene expression
GO:0006355	0.891	regulation of DNA-templated transcription
GO:0051254	0.884	positive regulation of RNA metabolic process
GO:0009653	0.852	anatomical structure morphogenesis
GO:0048513	0.851	animal organ development
GO:0009987	0.844	cellular process
GO:0010557	0.834	positive regulation of macromolecule biosynthetic process
GO:0006357	0.805	regulation of transcription by RNA polymerase II
GO:0009887	0.766	animal organ morphogenesis
GO:0045893	0.696	positive regulation of DNA-templated transcription
GO:0001501	0.627	skeletal system development
GO:0009952	0.611	anterior/posterior pattern specification
GO:0043009	0.596	chordate embryonic development
GO:0045944	0.474	positive regulation of transcription by RNA polymerase II
GO:0048869	0.453	cellular developmental process
GO:0030154	0.303	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.688	cytoplasm
GO:0005829	0.582	cytosol
GO:0043232	0.535	intracellular non-membrane-bounded organelle
GO:0001650	0.328	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]