StarFunc result for job id P09086

User Input

>input (479 residues)
MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPS
TKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL
QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLS
HPQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTT
ISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKK
RTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSA
APMLPSPGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGG
GGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K3R5	0.718	0.718	3.757E-57	479	0.979	0.979	A0A0G2K3R5.pdb.gz	A0A0G2K3R5_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=1 SV=2
2	AFDB:B5ME60	0.389	0.322	7.975E-50	586	0.944	0.771	B5ME60.pdb.gz	B5ME60_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=4
3	AFDB:H0YKT2	0.375	0.297	5.357E-49	618	0.935	0.725	H0YKT2.pdb.gz	H0YKT2_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=2
4	AFDB:O13007	0.401	0.400	3.115E-33	480	0.614	0.613	O13007.pdb.gz	O13007_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct-2 PE=2 SV=1
5	AFDB:Q9UKI9	0.318	0.348	6.749E-24	436	0.453	0.498	Q9UKI9.pdb.gz	PO2F3_HUMAN POU domain, class 2, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=3
6	AFDB:O57602	0.337	0.262	8.598E-19	623	0.411	0.316	O57602.pdb.gz	O57602_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct1 PE=2 SV=1
7	AFDB:Q9VK71	0.339	0.186	8.631E-16	893	0.357	0.191	Q9VK71.pdb.gz	PDM2B_DROME POU domain protein 2, isoform B OS=Drosophila melanogaster OX=7227 GN=pdm2 PE=2 SV=2
8	AFDB:P20264	0.302	0.290	2.427E-15	500	0.288	0.276	P20264.pdb.gz	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
9	AFDB:Q08478	0.307	0.398	2.427E-15	358	0.225	0.302	Q08478.pdb.gz	PIT1_ONCMY Pituitary-specific positive transcription factor 1 OS=Oncorhynchus mykiss OX=8022 GN=pou1f1 PE=2 SV=1
10	AFDB:Q91989	0.297	0.331	2.140E-14	426	0.261	0.293	Q91989.pdb.gz	P5F13_XENLA POU domain, class 5, transcription factor 1.3 OS=Xenopus laevis OX=8355 GN=pou5f1.3 PE=1 SV=1
11	PDB:6t90K	0.145	0.931	1.328E-6	73	0.096	0.630	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
12	PDB:4egcA	0.106	0.097	2.809E-2	539	0.073	0.065	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:2hi3A	0.124	0.668	1.992E-1	73	0.027	0.178	2hi3A.pdb.gz
14	PDB:1b0nA	0.102	0.418	5.026E-1	103	0.027	0.126	1b0nA.pdb.gz	An evolutionary link between sporulation and prophage induction in the structure of a repressor:anti-repressor complex.
15	PDB:7fbyA	0.086	0.227	5.917E-1	153	0.017	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:2cg4A	0.087	0.230	6.597E-1	149	0.027	0.087	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:3f51A	0.103	0.433	6.597E-1	94	0.023	0.117	3f51A.pdb.gz
18	PDB:6jcxF	0.073	0.171	8.202E-1	186	0.046	0.118	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
19	PDB:3bviF	0.061	0.123	1.020	173	0.040	0.110	3bviF.pdb.gz	Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
20	PDB:4j1xC	0.097	0.211	1.020	195	0.021	0.051	4j1xC.pdb.gz	Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3R5	0.0	751	606	0.923	0.729	A0A0G2K3R5_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=1 SV=2
2	A0A0G2KAN4	0.0	748	547	0.923	0.808	A0A0G2KAN4_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=1 SV=2
3	A0A8I5ZSA9	0.0	848	440	0.900	0.980	A0A8I5ZSA9_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=3 SV=1
4	A0A8I6A150	0.0	642	661	0.768	0.557	A0A8I6A150_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=3 SV=1
5	A0A8I6A6L7	0.0	916	489	0.962	0.943	A0A8I6A6L7_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=3 SV=1
6	B5ME60	0.0	893	586	0.942	0.770	B5ME60_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=4
7	H0YKT2	0.0	860	618	0.933	0.723	H0YKT2_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=2
8	H0YLL6	0.0	898	485	0.967	0.955	H0YLL6_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=1
9	H0YNW1	0.0	821	424	0.885	1.000	H0YNW1_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=1
10	P09086	0.0	955	479	1.000	1.000	PO2F2_HUMAN POU domain, class 2, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=3
11	Q00196	0.0	899	463	0.952	0.985	PO2F2_MOUSE POU domain, class 2, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou2f2 PE=2 SV=4
12	U3KQ96	0.0	520	262	0.545	0.996	U3KQ96_HUMAN POU class 2 homeobox 2 (Fragment) OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=1
13	O13007	5.28e-150	438	480	0.597	0.596	O13007_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct-2 PE=2 SV=1
14	P31362	4.17e-111	337	431	0.449	0.499	PO2F3_MOUSE POU domain, class 2, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou2f3 PE=2 SV=3
15	Q9UKI9	1.77e-108	330	436	0.449	0.493	PO2F3_HUMAN POU domain, class 2, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=3
16	Q29076	1.22e-106	335	745	0.411	0.264	PO2F1_PIG POU domain, class 2, transcription factor 1 OS=Sus scrofa OX=9823 GN=POU2F1 PE=2 SV=1
17	P42571	3.71e-106	324	430	0.466	0.519	PO2F3_RAT POU domain, class 2, transcription factor 3 OS=Rattus norvegicus OX=10116 GN=Pou2f3 PE=2 SV=2
18	P31503	6.73e-102	320	632	0.418	0.316	PO2F1_RAT POU domain, class 2, transcription factor 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Pou2f1 PE=1 SV=2
19	P16143	2.35e-100	319	758	0.367	0.232	PO2F1_XENLA POU domain, class 2, transcription factor 1 OS=Xenopus laevis OX=8355 GN=pou2f1 PE=1 SV=3
20	P15143	8.68e-100	317	739	0.418	0.271	PO2F1_CHICK POU domain, class 2, transcription factor 1 OS=Gallus gallus OX=9031 GN=POU2F1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1.1e-13	62.1	Homeodomain
2	PF00157 Pou	6.3e-33	123.9	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000431603

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384273	0.917	Transcription factor p65
2	9606.ENSP00000226574	0.916	Nuclear factor NF-kappa-B p105 subunit
3	9606.ENSP00000267953	0.908	Bcl-2-related protein A1
4	9606.ENSP00000356840	0.907	POU domain, class 2, transcription factor 1
5	9606.ENSP00000260264	0.814	POU domain, class 2, transcription factor 3
6	9606.ENSP00000376786	0.802	POU domain class 2-associating factor 1
7	9606.ENSP00000231509	0.768	Glucocorticoid receptor
8	9606.ENSP00000375942	0.748	TATA-box-binding protein
9	9606.ENSP00000229330	0.741	Host cell factor C2
10	9606.ENSP00000379847	0.718	Zinc finger protein 143
11	9606.ENSP00000377969	0.700	General transcription factor IIF subunit 1
12	9606.ENSP00000359531	0.683	Transcription initiation factor IIB
13	9606.ENSP00000264157	0.676	Cyclin-T2
14	9606.ENSP00000293860	0.647	DNA-directed RNA polymerase III subunit RPC10
15	9606.ENSP00000219252	0.644	DNA-directed RNA polymerase II subunit RPB3
16	9606.ENSP00000324124	0.638	DNA-directed RNA polymerases I, II, and III subunit RPABC5
17	9606.ENSP00000261900	0.627	Cyclin-T1
18	9606.ENSP00000283875	0.626	General transcription factor IIE subunit 1
19	9606.ENSP00000329357	0.614	Transcription factor Sp1
20	9606.ENSP00000298532	0.613	snRNA-activating protein complex subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0043565	0.998	sequence-specific DNA binding
GO:0005515	0.981	protein binding
GO:1990837	0.962	sequence-specific double-stranded DNA binding
GO:0008134	0.799	transcription factor binding
GO:0000976	0.757	transcription cis-regulatory region binding
GO:0000981	0.718	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.621	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.423	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.997	regulation of gene expression
GO:0051252	0.986	regulation of RNA metabolic process
GO:0006355	0.977	regulation of DNA-templated transcription
GO:0009987	0.495	cellular process
GO:0009893	0.390	positive regulation of metabolic process
GO:0010604	0.383	positive regulation of macromolecule metabolic process
GO:0006357	0.379	regulation of transcription by RNA polymerase II
GO:0050896	0.368	response to stimulus
GO:0048522	0.318	positive regulation of cellular process
GO:0045935	0.307	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.410	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]