StarFunc result for job id P09110

User Input

>input (424 residues)
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTT
PDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVN
RQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIP
MGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSI
TVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPI
LGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLR
LPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE
YPGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2M6	0.962	0.962	2.971E-92	424	1.000	1.000	A0A024R2M6.pdb.gz	A0A024R2M6_HUMAN Acetyl-Coenzyme A acyltransferase 1 (Peroxisomal 3-oxoacyl-Coenzyme A thiolase), isoform CRA_a OS=Homo sapiens OX=9606 GN=ACAA1 PE=2 SV=1
2	PDB:2iikB	0.934	0.990	5.697E-80	400	0.925	0.980	2iikB.pdb.gz
3	AFDB:P21775	0.941	0.920	1.370E-78	434	0.861	0.841	P21775.pdb.gz	THIKA_RAT 3-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus norvegicus OX=10116 GN=Acaa1a PE=1 SV=3
4	AFDB:Q8LF48	0.921	0.882	1.046E-65	443	0.571	0.546	Q8LF48.pdb.gz	THIK1_ARATH 3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=KAT1 PE=1 SV=2
5	AFDB:C8YNG6	0.915	0.841	5.326E-63	462	0.561	0.515	C8YNG6.pdb.gz	KAT1_PETHY 3-ketoacyl CoA thiolase 1, peroxisomal OS=Petunia hybrida OX=4102 GN=KAT1 PE=1 SV=1
6	AFDB:Q56WD9	0.912	0.837	6.768E-63	462	0.561	0.515	Q56WD9.pdb.gz	THIK2_ARATH 3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PED1 PE=1 SV=2
7	PDB:2wu9A	0.904	0.950	1.821E-61	403	0.538	0.566	2wu9A.pdb.gz
8	AFDB:Q570C8	0.897	0.833	6.434E-61	457	0.552	0.512	Q570C8.pdb.gz	THIK5_ARATH 3-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=KAT5 PE=1 SV=2
9	AFDB:Q5BEI0	0.906	0.921	6.075E-54	417	0.479	0.487	Q5BEI0.pdb.gz	Q5BEI0_EMENI acetyl-CoA C-acetyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01050 PE=3 SV=1
10	AFDB:P27796	0.861	0.875	6.677E-53	417	0.483	0.492	P27796.pdb.gz	THIK_YEAST 3-ketoacyl-CoA thiolase, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POT1 PE=1 SV=1
11	AFDB:G8BBD5	0.888	0.929	1.742E-52	405	0.432	0.452	G8BBD5.pdb.gz	G8BBD5_CANPC Uncharacterized protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CPAR2_800020 PE=3 SV=1
12	AFDB:G8BEF7	0.887	0.953	6.912E-52	394	0.425	0.457	G8BEF7.pdb.gz	G8BEF7_CANPC Acetyl-CoA C-acyltransferase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=OCT1 PE=3 SV=1
13	PDB:1afwB	0.860	0.926	5.806E-50	393	0.483	0.522	1afwB.pdb.gz
14	PDB:2d3tC	0.855	0.928	3.481E-44	390	0.366	0.397	2d3tC.pdb.gz	Ligand-Induced Domain Rearrangement of Fatty Acid beta-Oxidation Multienzyme Complex
15	PDB:1wl4A	0.818	0.879	4.863E-43	394	0.380	0.409	1wl4A.pdb.gz	High Resolution Crystal Structures of Human Cytosolic Thiolase (CT): A Comparison of the Active Sites of Human CT, Bacterial Thiolase, and Bacterial KAS I
16	PDB:1pxtB	0.758	0.921	1.313E-41	348	0.422	0.514	1pxtB.pdb.gz
17	PDB:4wysA	0.816	0.872	3.426E-41	396	0.380	0.407	4wysA.pdb.gz
18	PDB:4c2kD	0.816	0.866	5.211E-41	399	0.358	0.381	4c2kD.pdb.gz
19	PDB:4b3iD	0.824	0.866	2.413E-39	403	0.344	0.362	4b3iD.pdb.gz	Structure of Mycobacterial Beta-Oxidation Trifunctional Enzyme Reveals its Altered Assembly and Putative Substrate Channeling Pathway.
20	PDB:4ubtA	0.850	0.908	5.929E-39	396	0.335	0.359	4ubtA.pdb.gz	FadA5 a Thiolase from Mycobacterium tuberculosis: A Steroid-Binding Pocket Reveals the Potential for Drug Development against Tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R2M6	0.0	860	424	1.000	1.000	A0A024R2M6_HUMAN Acetyl-Coenzyme A acyltransferase 1 (Peroxisomal 3-oxoacyl-Coenzyme A thiolase), isoform CRA_a OS=Homo sapiens OX=9606 GN=ACAA1 PE=2 SV=1
2	P07871	0.0	750	424	0.870	0.870	THIKB_RAT 3-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus norvegicus OX=10116 GN=Acaa1b PE=1 SV=2
3	P09110	0.0	860	424	1.000	1.000	THIK_HUMAN 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=2
4	P21775	0.0	747	434	0.866	0.846	THIKA_RAT 3-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus norvegicus OX=10116 GN=Acaa1a PE=1 SV=3
5	Q8VCH0	0.0	741	424	0.858	0.858	THIKB_MOUSE 3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus OX=10090 GN=Acaa1b PE=1 SV=1
6	Q921H8	0.0	739	424	0.856	0.856	THIKA_MOUSE 3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus OX=10090 GN=Acaa1a PE=1 SV=1
7	Q8LF48	2.28e-161	463	443	0.573	0.549	THIK1_ARATH 3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=KAT1 PE=1 SV=2
8	C8YNG6	4.62e-157	453	462	0.566	0.519	KAT1_PETHY 3-ketoacyl CoA thiolase 1, peroxisomal OS=Petunia hybrida OX=4102 GN=KAT1 PE=1 SV=1
9	Q56WD9	1.51e-155	449	462	0.564	0.517	THIK2_ARATH 3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PED1 PE=1 SV=2
10	Q570C8	4.66e-154	445	457	0.564	0.523	THIK5_ARATH 3-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=KAT5 PE=1 SV=2
11	P27796	1.09e-127	377	417	0.521	0.530	THIK_YEAST 3-ketoacyl-CoA thiolase, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POT1 PE=1 SV=1
12	Q5BEI0	9.01e-125	369	417	0.502	0.511	Q5BEI0_EMENI acetyl-CoA C-acetyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01050 PE=3 SV=1
13	G8BBD5	3.46e-112	337	405	0.434	0.454	G8BBD5_CANPC Uncharacterized protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CPAR2_800020 PE=3 SV=1
14	G8BEF7	8.69e-110	330	394	0.425	0.457	G8BEF7_CANPC Acetyl-CoA C-acyltransferase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=OCT1 PE=3 SV=1
15	P21151	7.94e-81	256	387	0.401	0.439	FADA_ECOLI 3-ketoacyl-CoA thiolase FadA OS=Escherichia coli (strain K12) OX=83333 GN=fadA PE=1 SV=3
16	P28790	9.12e-81	256	391	0.377	0.409	FADA_PSEFR 3-ketoacyl-CoA thiolase OS=Pseudomonas fragi OX=296 GN=fadA PE=1 SV=2
17	P76461	8.02e-78	248	394	0.389	0.419	ATOB_ECOLI Acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=atoB PE=1 SV=1
18	Q9BWD1	9.67e-77	245	397	0.387	0.413	THIC_HUMAN Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2
19	Q46939	8.03e-76	243	393	0.356	0.384	YQEF_ECOLI Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=yqeF PE=3 SV=2
20	Q7ZVG1	8.71e-76	243	397	0.370	0.395	Q7ZVG1_DANRE 3-ketoacyl-CoA thiolase, mitochondrial OS=Danio rerio OX=7955 GN=zgc:56036 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08545 ACP_syn_III	30	15.9	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III
2	PF08541 ACP_syn_III_C	0.062	24.8	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal
3	PF00109 ketoacyl-synt	14	16.7	Beta-ketoacyl synthase, N-terminal domain
4	PF02803 Thiolase_C	1.2e-45	165.5	Thiolase, C-terminal domain
5	PF00108 Thiolase_N	2.1e-84	294.6	Thiolase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333664

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420914	0.998	Peroxisomal multifunctional enzyme type 2
2	9606.ENSP00000293217	0.992	Peroxisomal acyl-coenzyme A oxidase 1
3	9606.ENSP00000315680	0.991	Peroxisomal targeting signal 2 receptor
4	9606.ENSP00000474560	0.990	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
5	9606.ENSP00000231887	0.989	Peroxisomal bifunctional enzyme
6	9606.ENSP00000370023	0.984	Trifunctional enzyme subunit alpha, mitochondrial
7	9606.ENSP00000242592	0.981	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
8	9606.ENSP00000287078	0.981	Peroxisomal leader peptide-processing protease
9	9606.ENSP00000357873	0.981	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
10	9606.ENSP00000263038	0.980	Phytanoyl-CoA dioxygenase, peroxisomal
11	9606.ENSP00000438689	0.979	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
12	9606.ENSP00000348775	0.977	Peroxisomal acyl-coenzyme A oxidase 3
13	9606.ENSP00000322706	0.965	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
14	9606.ENSP00000358414	0.965	Hydroxymethylglutaryl-CoA synthase, mitochondrial
15	9606.ENSP00000381654	0.964	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
16	9606.ENSP00000264167	0.963	Alkyldihydroxyacetonephosphate synthase, peroxisomal
17	9606.ENSP00000360569	0.959	Non-specific lipid-transfer protein
18	9606.ENSP00000363614	0.959	Hydroxymethylglutaryl-CoA lyase, mitochondrial
19	9606.ENSP00000233710	0.957	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
20	9606.ENSP00000168216	0.940	3-hydroxyacyl-CoA dehydrogenase type-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003988	0.999	acetyl-CoA C-acyltransferase activity
GO:0016491	0.905	oxidoreductase activity
GO:0016627	0.766	oxidoreductase activity, acting on the CH-CH group of donors
GO:0016407	0.653	acetyltransferase activity
GO:0016453	0.644	C-acetyltransferase activity
GO:0003985	0.354	acetyl-CoA C-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006631	0.994	fatty acid metabolic process
GO:0009062	0.973	fatty acid catabolic process
GO:0019395	0.962	fatty acid oxidation
GO:0006635	0.934	fatty acid beta-oxidation
GO:0008206	0.744	bile acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005777	0.995	peroxisome
GO:0070013	0.959	intracellular organelle lumen
GO:0005739	0.958	mitochondrion
GO:0005829	0.922	cytosol
GO:0016020	0.805	membrane
GO:0031907	0.308	microbody lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21564	0.999	acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA
EC:2.3.1.16	0.999	acetyl-CoA C-acyltransferase.
EC:1.-.-.-	0.905	Oxidoreductases.
EC:1.3.-.-	0.766	Acting on the CH-CH group of donors.
RHEA:21036	0.354	2 acetyl-CoA = acetoacetyl-CoA + CoA
EC:2.3.1.9	0.354	acetyl-CoA C-acetyltransferase.

[back to server]