StarFunc result for job id P09172

User Input

>input (617 residues)
MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPLDPEGSLE
LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQK
GQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSL
EAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTKGNEALVHHMEVFQCAPEMDSVPHFSGPCDSKMKPDRLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRF
NAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFT
SVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
GRSPAGPTVVSIGGGKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09172	1.000	1.000	0.000	617	1.000	1.000	P09172.pdb.gz	DOPO_HUMAN Dopamine beta-hydroxylase OS=Homo sapiens OX=9606 GN=DBH PE=1 SV=3
2	AFDB:P15101	0.866	0.875	0.000	610	0.830	0.839	P15101.pdb.gz	DOPO_BOVIN Dopamine beta-hydroxylase OS=Bos taurus OX=9913 GN=DBH PE=1 SV=2
3	AFDB:Q64237	0.861	0.855	6.743E-102	622	0.786	0.780	Q64237.pdb.gz	DOPO_MOUSE Dopamine beta-hydroxylase OS=Mus musculus OX=10090 GN=Dbh PE=1 SV=2
4	AFDB:Q05754	0.869	0.865	3.465E-99	620	0.771	0.768	Q05754.pdb.gz	DOPO_RAT Dopamine beta-hydroxylase OS=Rattus norvegicus OX=10116 GN=Dbh PE=1 SV=1
5	PDB:4zelA	0.873	0.979	1.939E-98	550	0.887	0.995	4zelA.pdb.gz	The crystal structure of human dopamine beta-hydroxylase at 2.9 angstrom resolution.
6	AFDB:H0Z5G7	0.782	0.752	6.357E-94	643	0.697	0.669	H0Z5G7.pdb.gz	H0Z5G7_TAEGU Dopamine beta-hydroxylase OS=Taeniopygia guttata OX=59729 GN=DBH PE=3 SV=2
7	AFDB:A0A2R8QLP9	0.833	0.837	7.883E-87	614	0.590	0.593	A0A2R8QLP9.pdb.gz
8	AFDB:Q86B61	0.808	0.748	3.589E-64	670	0.370	0.340	Q86B61.pdb.gz	TBH1_DROME Tyramine beta-hydroxylase OS=Drosophila melanogaster OX=7227 GN=Tbh PE=1 SV=1
9	AFDB:Q9XTQ6	0.783	0.738	4.344E-59	657	0.319	0.300	Q9XTQ6.pdb.gz	TBH1_CAEEL Tyramine beta-hydroxylase OS=Caenorhabditis elegans OX=6239 GN=tbh-1 PE=1 SV=3
10	AFDB:Q6UVY6	0.814	0.819	3.384E-56	613	0.297	0.299	Q6UVY6.pdb.gz	MOXD1_HUMAN DBH-like monooxygenase protein 1 OS=Homo sapiens OX=9606 GN=MOXD1 PE=1 SV=1
11	AFDB:Q6NP60	0.786	0.644	4.656E-49	760	0.250	0.203	Q6NP60.pdb.gz	MOX12_DROME MOXD1 homolog 2 OS=Drosophila melanogaster OX=7227 GN=olf413 PE=2 SV=1
12	PDB:1tg7A	0.122	0.087	4.221E-4	971	0.070	0.044	1tg7A.pdb.gz	Crystal Structures of beta-Galactosidase from Penicillium sp. and its Complex with Galactose
13	PDB:2vvfA	0.212	0.397	6.076E-4	269	0.055	0.126	2vvfA.pdb.gz	Insights Into Virus Evolution and Membrane Biogenesis from the Structure of the Marine Lipid-Containing Bacteriophage Pm2.
14	PDB:7kveB	0.123	0.067	5.126E-3	1374	0.066	0.030	7kveB.pdb.gz
15	PDB:6vlsD	0.106	0.074	7.378E-3	963	0.060	0.038	6vlsD.pdb.gz
16	PDB:1o59A	0.112	0.196	1.307E-2	318	0.065	0.126	1o59A.pdb.gz
17	PDB:5jovA	0.067	0.052	1.696E-2	949	0.068	0.044	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
18	PDB:5azaA	0.092	0.074	1.786E-2	836	0.073	0.054	5azaA.pdb.gz	Rational design of crystal contact-free space in protein crystals for analyzing spatial distribution of motions within protein molecules.
19	PDB:4bxsV	0.132	0.074	1.882E-2	1262	0.055	0.027	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
20	PDB:5eiyB	0.108	0.103	2.200E-2	658	0.049	0.046	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DGL8	0.0	758	614	0.579	0.581	B3DGL8_DANRE Dopamine beta-hydroxylase OS=Danio rerio OX=7955 GN=DBH PE=2 SV=1
2	H0Z5G7	0.0	910	643	0.694	0.666	H0Z5G7_TAEGU Dopamine beta-hydroxylase OS=Taeniopygia guttata OX=59729 GN=DBH PE=3 SV=2
3	P09172	0.0	1289	617	1.000	1.000	DOPO_HUMAN Dopamine beta-hydroxylase OS=Homo sapiens OX=9606 GN=DBH PE=1 SV=3
4	P15101	0.0	1097	610	0.831	0.841	DOPO_BOVIN Dopamine beta-hydroxylase OS=Bos taurus OX=9913 GN=DBH PE=1 SV=2
5	Q05754	0.0	1006	620	0.767	0.763	DOPO_RAT Dopamine beta-hydroxylase OS=Rattus norvegicus OX=10116 GN=Dbh PE=1 SV=1
6	Q64237	0.0	1041	622	0.791	0.785	DOPO_MOUSE Dopamine beta-hydroxylase OS=Mus musculus OX=10090 GN=Dbh PE=1 SV=2
7	Q86B61	8.32e-125	385	670	0.361	0.333	TBH1_DROME Tyramine beta-hydroxylase OS=Drosophila melanogaster OX=7227 GN=Tbh PE=1 SV=1
8	Q9XTQ6	6.10e-110	346	657	0.319	0.300	TBH1_CAEEL Tyramine beta-hydroxylase OS=Caenorhabditis elegans OX=6239 GN=tbh-1 PE=1 SV=3
9	Q6UVY6	8.13e-88	287	613	0.300	0.302	MOXD1_HUMAN DBH-like monooxygenase protein 1 OS=Homo sapiens OX=9606 GN=MOXD1 PE=1 SV=1
10	Q6NP60	1.37e-54	200	760	0.229	0.186	MOX12_DROME MOXD1 homolog 2 OS=Drosophila melanogaster OX=7227 GN=olf413 PE=2 SV=1
11	P14925	7.87e-21	99.8	976	0.143	0.090	AMD_RAT Peptidylglycine alpha-amidating monooxygenase OS=Rattus norvegicus OX=10116 GN=Pam PE=1 SV=1
12	P97467	2.97e-20	97.8	979	0.136	0.086	AMD_MOUSE Peptidyl-glycine alpha-amidating monooxygenase OS=Mus musculus OX=10090 GN=Pam PE=1 SV=2
13	P10731	6.56e-19	93.6	972	0.135	0.085	AMD_BOVIN Peptidyl-glycine alpha-amidating monooxygenase OS=Bos taurus OX=9913 GN=PAM PE=1 SV=2
14	P19021	6.86e-19	93.6	973	0.138	0.087	AMD_HUMAN Peptidyl-glycine alpha-amidating monooxygenase OS=Homo sapiens OX=9606 GN=PAM PE=1 SV=2
15	O01404	2.16e-11	68.2	365	0.128	0.216	PHM_DROME Peptidylglycine alpha-hydroxylating monooxygenase OS=Drosophila melanogaster OX=7227 GN=Phm PE=1 SV=2
16	Q7TMA5	0.24	37.4	4743	0.075	0.010	APOB_RAT Apolipoprotein B-100 OS=Rattus norvegicus OX=10116 GN=Apob PE=1 SV=1
17	Q2TFN9	0.28	36.6	840	0.062	0.045	HSP74_CANLF Heat shock 70 kDa protein 4 OS=Canis lupus familiaris OX=9615 GN=HSPA4 PE=1 SV=1
18	Q61316	0.39	36.2	841	0.062	0.045	HSP74_MOUSE Heat shock 70 kDa protein 4 OS=Mus musculus OX=10090 GN=Hspa4 PE=1 SV=1
19	P34932	0.51	35.8	840	0.062	0.045	HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4
20	O88600	0.54	35.8	840	0.062	0.045	HSP74_RAT Heat shock 70 kDa protein 4 OS=Rattus norvegicus OX=10116 GN=Hspa4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01082 Cu2_monooxygen	4.1e-42	154.9	Copper type II ascorbate-dependent monooxygenase, N-terminal domain
2	PF03712 Cu2_monoox_C	3.2e-61	216.9	Copper type II ascorbate-dependent monooxygenase, C-terminal domain
3	PF03351 DOMON	3.4e-23	93.6	DOMON domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376776

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269582	0.989	Phenylethanolamine N-methyltransferase
2	9606.ENSP00000403644	0.987	Aromatic-L-amino-acid decarboxylase
3	9606.ENSP00000354511	0.971	Catechol O-methyltransferase
4	9606.ENSP00000340684	0.962	Amine oxidase [flavin-containing] A
5	9606.ENSP00000367309	0.950	Amine oxidase [flavin-containing] B
6	9606.ENSP00000370571	0.945	Tyrosine 3-monooxygenase
7	9606.ENSP00000305742	0.905	Transmembrane O-methyltransferase
8	9606.ENSP00000312326	0.901	Membrane primary amine oxidase
9	9606.ENSP00000253799	0.900	Retina-specific copper amine oxidase
10	9606.ENSP00000226382	0.826	Paired mesoderm homeobox protein 2B
11	9606.ENSP00000384364	0.825	Pro-neuropeptide Y
12	9606.ENSP00000298231	0.792	Paired mesoderm homeobox protein 2A
13	9606.ENSP00000250018	0.789	Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
14	9606.ENSP00000270349	0.770	Sodium-dependent dopamine transporter
15	9606.ENSP00000306129	0.763	D(1B) dopamine receptor
16	9606.ENSP00000298472	0.761	Synaptic vesicular amine transporter
17	9606.ENSP00000219833	0.748	Sodium-dependent noradrenaline transporter
18	9606.ENSP00000331746	0.747	Calcitonin
19	9606.ENSP00000448059	0.746	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
20	9606.ENSP00000287641	0.743	Somatostatin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005507	1.000	copper ion binding
GO:0004500	1.000	dopamine beta-monooxygenase activity
GO:0005515	0.993	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0009712	0.946	catechol-containing compound metabolic process
GO:0019336	0.921	phenol-containing compound catabolic process
GO:0006807	0.910	nitrogen compound metabolic process
GO:0006584	0.896	catecholamine metabolic process
GO:1901617	0.887	organic hydroxy compound biosynthetic process
GO:0044249	0.874	cellular biosynthetic process
GO:0046189	0.828	phenol-containing compound biosynthetic process
GO:0042417	0.750	dopamine metabolic process
GO:0042402	0.691	cellular biogenic amine catabolic process
GO:0034641	0.656	cellular nitrogen compound metabolic process
GO:0065007	0.569	biological regulation
GO:0009713	0.547	catechol-containing compound biosynthetic process
GO:0007154	0.496	cell communication
GO:0023052	0.468	signaling
GO:0050896	0.459	response to stimulus
GO:1901566	0.428	organonitrogen compound biosynthetic process
GO:0050794	0.419	regulation of cellular process
GO:0032501	0.372	multicellular organismal process
GO:0042401	0.364	biogenic amine biosynthetic process
GO:0007267	0.361	cell-cell signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0031090	0.998	organelle membrane
GO:0031410	0.998	cytoplasmic vesicle
GO:0098588	0.992	bounding membrane of organelle
GO:0070013	0.989	intracellular organelle lumen
GO:0099503	0.969	secretory vesicle
GO:0005576	0.954	extracellular region
GO:0030659	0.949	cytoplasmic vesicle membrane
GO:0030141	0.936	secretory granule
GO:0030667	0.899	secretory granule membrane
GO:0031983	0.804	vesicle lumen
GO:0060205	0.788	cytoplasmic vesicle lumen
GO:0034774	0.771	secretory granule lumen
GO:0043228	0.698	non-membrane-bounded organelle
GO:0005886	0.646	plasma membrane
GO:0043232	0.639	intracellular non-membrane-bounded organelle
GO:0005615	0.571	extracellular space
GO:0005634	0.536	nucleus
GO:0005829	0.363	cytosol
GO:0031981	0.337	nuclear lumen
GO:0005654	0.320	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19117	1.000	dopamine + 2 L-ascorbate + O2 = (R)-noradrenaline + H2O + 2 monodehydro-L-ascorbate radical
EC:1.14.17.1	1.000	dopamine beta-monooxygenase.

[back to server]