StarFunc result for job id P09327

User Input

>input (827 residues)
MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSY
DIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKG
GVASGMKHVETNSYDVQRLLHVKGKRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGP
ESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAV
PDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKG
KKANEQEKKGAMSHALNFIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWTASNRTSGLGK
THTVGSVAKVEQVKFDATSMHVKPQVAAQQKMVDDGSGEVQVWRIENLELVPVDSKWLGH
FYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVP
MGKEPPHLMSIFKGRMVVYQGGTSRTNNLETGPSTRLFQVQGTGANNTKAFEVPARANFL
NSNDVFVLKTQSCCYLWCGKGCSGDEREMAKMVADTISRTEKQVVVEGQEPANFWMALGG
KAPYANTKRLQEENLVITPRLFECSNKTGRFLATEIPDFNQDDLEEDDVFLLDVWDQVFF
WIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQGHEPPTFTGWFLAWDPFKWS
NTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLPIFPLEQLVNKPVEEL
PEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEKGLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75366	0.595	0.600	0.000	819	0.602	0.608	O75366.pdb.gz	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
2	AFDB:O88398	0.858	0.866	0.000	819	0.602	0.608	O88398.pdb.gz	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
3	AFDB:P09327	1.000	1.000	0.000	827	1.000	1.000	P09327.pdb.gz	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
4	AFDB:O15195	0.534	0.516	1.191E-102	856	0.484	0.467	O15195.pdb.gz	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
5	AFDB:P06396	0.548	0.579	8.865E-91	782	0.434	0.459	P06396.pdb.gz	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
6	PDB:6jegB	0.527	0.604	5.146E-86	718	0.432	0.497	6jegB.pdb.gz
7	AFDB:Q5ZIV9	0.368	0.421	2.966E-85	717	0.411	0.474	Q5ZIV9.pdb.gz	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
8	AFDB:E9PU64	0.369	0.422	4.104E-85	715	0.407	0.471	E9PU64.pdb.gz	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
9	AFDB:A0A0R4IQ11	0.422	0.474	3.210E-84	720	0.409	0.469	A0A0R4IQ11.pdb.gz
10	AFDB:Q07171	0.516	0.534	4.350E-74	798	0.314	0.326	Q07171.pdb.gz	GELS_DROME Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2
11	AFDB:O81644	0.482	0.415	2.521E-72	976	0.336	0.285	O81644.pdb.gz	VILI2_ARATH Villin-2 OS=Arabidopsis thaliana OX=3702 GN=VLN2 PE=1 SV=2
12	PDB:1j72A	0.125	0.297	3.814E-33	337	0.187	0.460	1j72A.pdb.gz
13	PDB:7cccB	0.096	0.214	1.597E-5	342	0.037	0.091	7cccB.pdb.gz	The structure of the actin filament uncapping complex mediated by twinfilin.
14	PDB:6g2iA	0.085	0.045	3.583E-3	2080	0.052	0.021	6g2iA.pdb.gz
15	PDB:2i2qA	0.085	0.421	5.832E-3	122	0.018	0.123	2i2qA.pdb.gz
16	PDB:6g2dC	0.070	0.038	1.117E-2	2121	0.035	0.014	6g2dC.pdb.gz
17	PDB:1udmA	0.092	0.417	1.464E-2	149	0.013	0.074	1udmA.pdb.gz
18	PDB:2zxcA	0.079	0.095	1.545E-2	643	0.047	0.061	2zxcA.pdb.gz	Mechanistic insights into the hydrolysis and synthesis of ceramide by neutral ceramidase.
19	PDB:2mv2A	0.073	0.347	2.655E-2	148	0.012	0.068	2mv2A.pdb.gz
20	PDB:3c7nA	0.062	0.074	2.802E-2	649	0.048	0.062	3c7nA.pdb.gz	Structure of the Hsp110:Hsc70 nucleotide exchange machine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JMJ1	0.0	665	720	0.407	0.468	A0JMJ1_DANRE Scinderin like a OS=Danio rerio OX=7955 GN=fb94b12 PE=1 SV=2
2	B4DV78	0.0	1083	516	0.624	1.000	B4DV78_HUMAN Villin 1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=1
3	E9PU64	0.0	682	715	0.410	0.474	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
4	G1U9R8	0.0	687	739	0.433	0.484	G1U9R8_RABIT Gelsolin OS=Oryctolagus cuniculus OX=9986 GN=GSN PE=3 SV=3
5	O15195	0.0	788	856	0.484	0.467	VILL_HUMAN Villin-like protein OS=Homo sapiens OX=9606 GN=VILL PE=1 SV=3
6	O75366	0.0	1060	819	0.605	0.611	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
7	O88398	0.0	1039	819	0.602	0.608	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
8	P06396	0.0	697	782	0.437	0.462	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
9	P09327	0.0	1725	827	1.000	1.000	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
10	P13020	0.0	684	780	0.428	0.454	GELS_MOUSE Gelsolin OS=Mus musculus OX=10090 GN=Gsn PE=1 SV=3
11	P20305	0.0	696	772	0.434	0.465	GELS_PIG Gelsolin (Fragment) OS=Sus scrofa OX=9823 GN=GSN PE=1 SV=1
12	Q28046	0.0	678	715	0.406	0.470	SCIN_BOVIN Scinderin OS=Bos taurus OX=9913 GN=SCIN PE=1 SV=1
13	Q5ZIV9	0.0	688	717	0.411	0.474	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
14	Q60604	0.0	679	715	0.409	0.473	SCIN_MOUSE Scinderin OS=Mus musculus OX=10090 GN=Scin PE=1 SV=3
15	Q62468	0.0	1565	827	0.901	0.901	VILI_MOUSE Villin-1 OS=Mus musculus OX=10090 GN=Vil1 PE=1 SV=3
16	Q68FP1	0.0	687	780	0.432	0.458	GELS_RAT Gelsolin OS=Rattus norvegicus OX=10116 GN=Gsn PE=1 SV=1
17	Q7TQ08	0.0	679	715	0.407	0.471	Q7TQ08_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=2 SV=1
18	Q9WU06	0.0	1045	819	0.613	0.619	AVIL_RAT Advillin OS=Rattus norvegicus OX=10116 GN=Avil PE=2 SV=2
19	Q9Y6U3	0.0	675	715	0.412	0.477	SCIN_HUMAN Scinderin OS=Homo sapiens OX=9606 GN=SCIN PE=1 SV=4
20	Q07171	2.08e-124	395	798	0.318	0.330	GELS_DROME Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00626 Gelsolin	2.4e-105	355.9	Gelsolin repeat
2	PF02209 VHP	4.3e-13	60.3	Villin headpiece domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248444

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348054	0.729	COMM domain containing 6
2	9606.ENSP00000236979	0.727	Spermatid nuclear transition protein 1
3	9606.ENSP00000244007	0.702	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
4	9606.ENSP00000266674	0.614	Leucine-rich repeat-containing G-protein coupled receptor 5
5	9606.ENSP00000216492	0.602	Chromogranin-A
6	9606.ENSP00000233202	0.581	Natural resistance-associated macrophage protein 1
7	9606.ENSP00000219022	0.573	Olfactomedin-4
8	9606.ENSP00000307280	0.560	Myosin light chain 1/3, skeletal muscle isoform
9	9606.ENSP00000270560	0.539	Transmembrane 4 L six family member 5
10	9606.ENSP00000354774	0.537	SPRY domain containing 7
11	9606.ENSP00000391747	0.537	Laccase domain-containing protein 1
12	9606.ENSP00000407763	0.537	Coiled-coil domain containing 122
13	9606.ENSP00000283713	0.536	Villin-like protein
14	9606.ENSP00000458162	0.536	Actin, cytoplasmic 2
15	9606.ENSP00000258399	0.526	Ubiquitin carboxyl-terminal hydrolase 37
16	9606.ENSP00000427679	0.526	Microsomal triglyceride transfer protein large subunit
17	9606.ENSP00000295834	0.525	Fatty acid-binding protein, liver
18	9606.ENSP00000260599	0.524	Ketohexokinase
19	9606.ENSP00000274024	0.522	Fatty acid-binding protein, intestinal
20	9606.ENSP00000370408	0.522	Homeobox protein CDX-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0044877	0.989	protein-containing complex binding
GO:0051015	0.967	actin filament binding
GO:0043167	0.611	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050896	0.945	response to stimulus
GO:0048518	0.940	positive regulation of biological process
GO:0048522	0.922	positive regulation of cellular process
GO:0071840	0.908	cellular component organization or biogenesis
GO:0016043	0.904	cellular component organization
GO:0051128	0.890	regulation of cellular component organization
GO:0097435	0.887	supramolecular fiber organization
GO:0031344	0.838	regulation of cell projection organization
GO:0030029	0.837	actin filament-based process
GO:0051130	0.813	positive regulation of cellular component organization
GO:0007015	0.786	actin filament organization
GO:0048519	0.740	negative regulation of biological process
GO:0048523	0.730	negative regulation of cellular process
GO:0022607	0.729	cellular component assembly
GO:0032501	0.676	multicellular organismal process
GO:0065008	0.669	regulation of biological quality
GO:0044087	0.658	regulation of cellular component biogenesis
GO:0048856	0.635	anatomical structure development
GO:0019222	0.593	regulation of metabolic process
GO:0031346	0.584	positive regulation of cell projection organization
GO:0110053	0.580	regulation of actin filament organization
GO:0010639	0.555	negative regulation of organelle organization
GO:0030837	0.546	negative regulation of actin filament polymerization
GO:0050793	0.543	regulation of developmental process
GO:1902743	0.540	regulation of lamellipodium organization
GO:0051716	0.529	cellular response to stimulus
GO:0030835	0.526	negative regulation of actin filament depolymerization
GO:0051693	0.523	actin filament capping
GO:0023052	0.478	signaling
GO:0007154	0.478	cell communication
GO:0007165	0.474	signal transduction
GO:1902745	0.431	positive regulation of lamellipodium organization
GO:0080090	0.378	regulation of primary metabolic process
GO:0031323	0.321	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0071944	0.972	cell periphery
GO:0016020	0.971	membrane
GO:0005886	0.963	plasma membrane
GO:0042995	0.962	cell projection
GO:0043227	0.947	membrane-bounded organelle
GO:0120025	0.946	plasma membrane bounded cell projection
GO:0031252	0.867	cell leading edge
GO:0005737	0.857	cytoplasm
GO:0030027	0.840	lamellipodium
GO:0005576	0.835	extracellular region
GO:0043231	0.769	intracellular membrane-bounded organelle
GO:0005856	0.739	cytoskeleton
GO:0015629	0.722	actin cytoskeleton
GO:0098858	0.710	actin-based cell projection
GO:0031982	0.642	vesicle
GO:0005615	0.603	extracellular space
GO:0043230	0.596	extracellular organelle
GO:1903561	0.570	extracellular vesicle
GO:0070062	0.564	extracellular exosome
GO:0005829	0.418	cytosol
GO:0032991	0.326	protein-containing complex
GO:0099512	0.318	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]