StarFunc result for job id P09417

User Input

>input (244 residues)
MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSF
TEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSH
LATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAV
LPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELT
PAYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09417	1.000	1.000	9.810E-56	244	1.000	1.000	P09417.pdb.gz	DHPR_HUMAN Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR PE=1 SV=2
2	PDB:1dhrA	0.957	0.989	2.665E-47	236	0.926	0.958	1dhrA.pdb.gz	Crystal structure of rat liver dihydropteridine reductase.
3	AFDB:A7YT77	0.954	0.982	2.529E-43	237	0.693	0.713	A7YT77.pdb.gz	A7YT77_DANRE Qdpra protein OS=Danio rerio OX=7955 GN=si:ch211-89f22.2 PE=1 SV=1
4	AFDB:A2BIE9	0.961	0.981	5.054E-43	239	0.697	0.711	A2BIE9.pdb.gz
5	AFDB:Q86A17	0.865	0.911	2.536E-31	231	0.369	0.390	Q86A17.pdb.gz	DHPR_DICDI Dihydropteridine reductase OS=Dictyostelium discoideum OX=44689 GN=qdpr PE=1 SV=1
6	PDB:3orfA	0.899	0.952	3.133E-29	230	0.377	0.400	3orfA.pdb.gz	Structural insights into the dual substrate specificities of mammalian and Dictyostelium dihydropteridine reductases toward two stereoisomers of quinonoid dihydrobiopterin
7	AFDB:A0A1U8QGV2	0.715	0.586	5.254E-13	305	0.168	0.134	A0A1U8QGV2.pdb.gz	STCG_EMENI 5'-hydroxyaverantin dehydrogenase stcG OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=swtcG PE=2 SV=1
8	AFDB:P48814	0.665	0.636	6.345E-13	257	0.160	0.152	P48814.pdb.gz	ADH1_CERCA Alcohol dehydrogenase 1 OS=Ceratitis capitata OX=7213 GN=ADH1 PE=3 SV=1
9	PDB:5z2lK	0.726	0.726	1.395E-12	244	0.189	0.189	5z2lK.pdb.gz	A potential substrate binding pocket of BdcA plays a critical role in NADPH recognition and biofilm dispersal
10	AFDB:P39333	0.732	0.751	5.745E-12	237	0.205	0.211	P39333.pdb.gz	BDCA_ECOLI Cyclic-di-GMP-binding biofilm dispersal mediator protein OS=Escherichia coli (strain K12) OX=83333 GN=bdcA PE=1 SV=2
11	PDB:5ilgA	0.698	0.649	7.634E-12	265	0.172	0.158	5ilgA.pdb.gz	Structural Insights into the Drosophila melanogaster Retinol Dehydrogenase, a Member of the Short-Chain Dehydrogenase/Reductase Family.
12	AFDB:Q9VV42	0.707	0.631	1.573E-11	278	0.176	0.155	Q9VV42.pdb.gz	Q9VV42_DROME HL08057p OS=Drosophila melanogaster OX=7227 GN=Pdh PE=1 SV=1
13	PDB:6ujkA	0.687	0.682	1.625E-11	246	0.164	0.163	6ujkA.pdb.gz	Crystal Structure of a Probable short-chain type dehydrogenase/reductase (Rv1144) from Mycobacterium tuberculosis with bound NAD
14	AFDB:Q9NAR7	0.660	0.629	1.900E-11	258	0.148	0.140	Q9NAR7.pdb.gz	ADH_BACOL Alcohol dehydrogenase OS=Bactrocera oleae OX=104688 GN=ADH PE=2 SV=1
15	AFDB:Q9ZW20	0.735	0.676	2.295E-11	268	0.180	0.164	Q9ZW20.pdb.gz	TRNHD_ARATH Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana OX=3702 GN=At2g29370 PE=3 SV=1
16	PDB:2gdzA	0.710	0.657	4.737E-11	266	0.156	0.143	2gdzA.pdb.gz	High-Affinity Inhibitors of Human NAD-Dependent 15-Hydroxyprostaglandin Dehydrogenase: Mechanisms of Inhibition and Structure-Activity Relationships.
17	PDB:2ag5A	0.633	0.628	1.567E-10	246	0.168	0.167	2ag5A.pdb.gz	Characterization of human DHRS6, an orphan short chain dehydrogenase/reductase enzyme: a novel, cytosolic type 2 R-beta-hydroxybutyrate dehydrogenase
18	PDB:4cqmF	0.665	0.673	1.567E-10	241	0.156	0.158	4cqmF.pdb.gz	Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
19	PDB:1nffA	0.657	0.657	2.015E-10	244	0.184	0.184	1nffA.pdb.gz	Directed evolution approach to a structural genomics project: Rv2002 from Mycobacterium tuberculosis
20	PDB:1e3wD	0.708	0.682	4.027E-10	255	0.164	0.157	1e3wD.pdb.gz	Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09417	0.0	500	244	1.000	1.000	DHPR_HUMAN Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR PE=1 SV=2
2	P11348	2.25e-173	478	241	0.939	0.950	DHPR_RAT Dihydropteridine reductase OS=Rattus norvegicus OX=10116 GN=Qdpr PE=1 SV=1
3	Q8BVI4	7.86e-173	477	241	0.926	0.938	DHPR_MOUSE Dihydropteridine reductase OS=Mus musculus OX=10090 GN=Qdpr PE=1 SV=2
4	Q66IB5	2.67e-131	372	239	0.701	0.715	Q66IB5_DANRE Dihydropteridine reductase OS=Danio rerio OX=7955 GN=qdprb1 PE=1 SV=2
5	A7YT77	3.15e-128	364	237	0.680	0.700	A7YT77_DANRE Qdpra protein OS=Danio rerio OX=7955 GN=si:ch211-89f22.2 PE=1 SV=1
6	Q86A17	6.10e-58	185	231	0.377	0.398	DHPR_DICDI Dihydropteridine reductase OS=Dictyostelium discoideum OX=44689 GN=qdpr PE=1 SV=1
7	Q9SN58	0.021	38.1	351	0.180	0.125	UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana OX=3702 GN=UGE5 PE=1 SV=3
8	Q9FZ42	0.080	36.2	288	0.184	0.156	ADRC1_ARATH NADPH-dependent aldehyde reductase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ChlADR1 PE=1 SV=1
9	Q10216	0.11	35.8	286	0.111	0.094	YAY8_SCHPO Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.08 PE=3 SV=1
10	Q1MLL4	0.12	35.4	257	0.213	0.202	GDH_RHIL3 Galactitol 2-dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=gdh PE=1 SV=1
11	Q8MS37	0.12	35.8	715	0.160	0.055	Q8MS37_DROME RE15579p OS=Drosophila melanogaster OX=7227 GN=tyn PE=2 SV=1
12	O14351	0.27	34.3	247	0.143	0.142	YB45_SCHPO Uncharacterized oxidoreductase C30D10.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC30D10.05c PE=3 SV=1
13	P9WGR5	0.31	34.3	251	0.258	0.251	Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0484c PE=1 SV=1
14	Q00791	0.83	32.7	264	0.115	0.106	STCU_EMENI Versicolorin reductase stcU OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcU PE=2 SV=2
15	F1QUP2	1.2	32.3	293	0.135	0.113	F1QUP2_DANRE Estradiol 17-beta-dehydrogenase 1 OS=Danio rerio OX=7955 GN=hsd17b1 PE=1 SV=1
16	F4IKM1	1.6	32.0	307	0.111	0.088	TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana OX=3702 GN=At2g29340 PE=2 SV=1
17	Q6A1A4	1.9	32.0	338	0.098	0.071	Q6A1A4_AERHY UDP-glucose 4-epimerase OS=Aeromonas hydrophila OX=644 GN=galE PE=3 SV=2
18	Q9T0A7	2.5	31.6	350	0.119	0.083	UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana OX=3702 GN=UGE2 PE=1 SV=1
19	P09147	2.7	31.6	338	0.098	0.071	GALE_ECOLI UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) OX=83333 GN=galE PE=1 SV=1
20	Q09101	2.9	31.6	958	0.090	0.023	HIG_DROME Locomotion-related protein Hikaru genki OS=Drosophila melanogaster OX=7227 GN=hig PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00106 adh_short	0.00042	31.4	short chain dehydrogenase
2	PF13561 adh_short_C2	0.033	25.3	Enoyl-(Acyl carrier protein) reductase
3	PF01370 Epimerase	1.8	19.5	NAD dependent epimerase/dehydratase family
4	PF05185 PRMT5	4.5e+02	12.1	PRMT5 arginine-N-methyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352608	0.989	Ryanodine receptor 1
2	9606.ENSP00000299299	0.983	Pterin-4-alpha-carbinolamine dehydratase
3	9606.ENSP00000234454	0.982	Sepiapterin reductase
4	9606.ENSP00000448059	0.981	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
5	9606.ENSP00000396308	0.970	Dihydrofolate reductase
6	9606.ENSP00000250018	0.962	Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
7	9606.ENSP00000421544	0.959	Pterin-4-alpha-carbinolamine dehydratase 2
8	9606.ENSP00000370571	0.951	Tyrosine 3-monooxygenase
9	9606.ENSP00000285930	0.943	Aldose reductase
10	9606.ENSP00000377768	0.943	Dihydrofolate reductase 2, mitochondrial
11	9606.ENSP00000329093	0.940	Tryptophan hydroxylase 2
12	9606.ENSP00000352584	0.926	Aldo-keto reductase family 1 member B10
13	9606.ENSP00000260447	0.827	GTP cyclohydrolase 1 feedback regulatory protein
14	9606.ENSP00000379865	0.823	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
15	9606.ENSP00000371110	0.822	2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial
16	9606.ENSP00000358417	0.814	D-3-phosphoglycerate dehydrogenase
17	9606.ENSP00000355533	0.808	Ryanodine receptor 2
18	9606.ENSP00000286621	0.804	Adenosine kinase
19	9606.ENSP00000367615	0.802	Adenine phosphoribosyltransferase
20	9606.ENSP00000416583	0.798	Deoxyribose-phosphate aldolase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004155	0.997	6,7-dihydropteridine reductase activity
GO:0005488	0.982	binding
GO:0005515	0.972	protein binding
GO:0042802	0.466	identical protein binding
GO:0016616	0.429	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0042558	0.994	pteridine-containing compound metabolic process
GO:0006520	0.992	amino acid metabolic process
GO:0009058	0.304	biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0005576	0.976	extracellular region
GO:0031982	0.965	vesicle
GO:1903561	0.925	extracellular vesicle
GO:0070062	0.924	extracellular exosome
GO:0005739	0.901	mitochondrion
GO:0070013	0.603	intracellular organelle lumen
GO:0005634	0.384	nucleus
GO:0031981	0.371	nuclear lumen
GO:0042995	0.324	cell projection
GO:0120025	0.302	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.5.1.34	0.997	6,7-dihydropteridine reductase.
EC:1.1.1.-	0.429	With NAD(+) or NADP(+) as acceptor.

[back to server]