StarFunc result for job id P09429

User Input

>input (215 residues)
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09429	1.000	1.000	3.335E-29	215	1.000	1.000	P09429.pdb.gz	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
2	AFDB:F2Z594	0.465	0.455	1.835E-25	220	0.856	0.836	F2Z594.pdb.gz	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
3	AFDB:F1RJ01	0.420	0.429	2.246E-22	210	0.684	0.700	F1RJ01.pdb.gz	F1RJ01_PIG High mobility group box 2 OS=Sus scrofa OX=9823 GN=HMGB2 PE=3 SV=3
4	AFDB:P40618	0.440	0.466	2.403E-21	202	0.693	0.738	P40618.pdb.gz	HMGB3_CHICK High mobility group protein B3 OS=Gallus gallus OX=9031 GN=HMGB3 PE=2 SV=3
5	AFDB:Q6NX86	0.722	0.755	3.028E-21	205	0.674	0.707	Q6NX86.pdb.gz	Q6NX86_DANRE High mobility group box 1a OS=Danio rerio OX=7955 GN=HMGB1 PE=1 SV=1
6	AFDB:P07746	0.491	0.510	7.636E-21	204	0.642	0.676	P07746.pdb.gz	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
7	AFDB:X2JGB1	0.398	0.403	5.830E-19	212	0.600	0.608	X2JGB1.pdb.gz	X2JGB1_CYNSE Putative high mobility group B2 protein OS=Cynoglossus semilaevis OX=244447 GN=HMGB2 PE=2 SV=1
8	AFDB:P23497	0.457	0.121	7.859E-18	879	0.726	0.177	P23497.pdb.gz	SP100_HUMAN Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3
9	AFDB:Q24537	0.375	0.211	1.348E-15	393	0.465	0.254	Q24537.pdb.gz	HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster OX=7227 GN=Dsp1 PE=2 SV=1
10	AFDB:Q8WW32	0.389	0.446	6.117E-14	186	0.344	0.398	Q8WW32.pdb.gz	HMGB4_HUMAN High mobility group protein B4 OS=Homo sapiens OX=9606 GN=HMGB4 PE=1 SV=2
11	PDB:1j5nA	0.343	0.723	2.310E-4	93	0.191	0.441	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7ploI	0.217	0.106	5.041E-1	451	0.084	0.040	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:7pj1B	0.143	0.234	1.069	122	0.088	0.156	7pj1B.pdb.gz
14	PDB:6zm7CE	0.173	0.297	1.200	124	0.074	0.129	6zm7CE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
15	PDB:8ap8h	0.119	0.169	3.025	137	0.093	0.146	8ap8h.pdb.gz
16	PDB:2rvqD	0.145	0.227	3.205	129	0.042	0.070	2rvqD.pdb.gz
17	PDB:7k26D	0.154	0.183	3.396	176	0.098	0.119	7k26D.pdb.gz	Anisotropic Dynamics and Mechanics of Macromolecular Crystals Containing Lattice-Patterned Polymer Networks.
18	PDB:7b5sH	0.111	0.110	3.812	216	0.098	0.097	7b5sH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
19	PDB:6gejG	0.133	0.262	4.039	96	0.070	0.156	6gejG.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
20	PDB:7ktsD	0.126	0.124	4.039	219	0.084	0.082	7ktsD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09429	2.41e-151	420	215	1.000	1.000	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
2	P10103	1.08e-150	419	215	0.995	0.995	HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus OX=9913 GN=HMGB1 PE=1 SV=3
3	P63158	4.27e-150	417	215	0.991	0.991	HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus OX=10090 GN=Hmgb1 PE=1 SV=2
4	P63159	4.27e-150	417	215	0.991	0.991	HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus OX=10116 GN=Hmgb1 PE=1 SV=2
5	P12682	8.06e-150	416	215	0.991	0.991	HMGB1_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
6	F2Z594	4.53e-132	372	220	0.856	0.836	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
7	Q9YH06	3.82e-112	321	215	0.772	0.772	HMGB1_CHICK High mobility group protein B1 OS=Gallus gallus OX=9031 GN=HMGB1 PE=1 SV=1
8	F1NPU8	2.81e-103	298	207	0.707	0.734	F1NPU8_CHICK High mobility group box 2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=1 SV=1
9	P26584	5.25e-103	298	207	0.707	0.734	HMGB2_CHICK High mobility group protein B2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=2 SV=2
10	Q5U071	9.98e-101	292	208	0.721	0.745	Q5U071_HUMAN High-mobility group box 2 OS=Homo sapiens OX=9606 PE=2 SV=1
11	P26583	1.03e-100	292	209	0.721	0.742	HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2
12	P40673	1.03e-100	292	209	0.721	0.742	HMGB2_BOVIN High mobility group protein B2 OS=Bos taurus OX=9913 GN=HMGB2 PE=1 SV=3
13	P52925	1.10e-99	289	210	0.712	0.729	HMGB2_RAT High mobility group protein B2 OS=Rattus norvegicus OX=10116 GN=Hmgb2 PE=2 SV=2
14	P30681	3.83e-99	288	210	0.716	0.733	HMGB2_MOUSE High mobility group protein B2 OS=Mus musculus OX=10090 GN=Hmgb2 PE=1 SV=3
15	Q3U566	3.83e-99	288	210	0.716	0.733	Q3U566_MOUSE HMG box domain-containing protein OS=Mus musculus OX=10090 GN=Hmgb2 PE=2 SV=1
16	P07746	1.12e-98	286	204	0.642	0.676	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
17	Q6NX86	1.91e-96	281	205	0.674	0.707	Q6NX86_DANRE High mobility group box 1a OS=Danio rerio OX=7955 GN=HMGB1 PE=1 SV=1
18	F1RJ01	3.52e-94	275	210	0.660	0.676	F1RJ01_PIG High mobility group box 2 OS=Sus scrofa OX=9823 GN=HMGB2 PE=3 SV=3
19	P17741	4.24e-94	275	210	0.660	0.676	HMGB2_PIG High mobility group protein B2 OS=Sus scrofa OX=9823 GN=HMGB2 PE=1 SV=2
20	X2JGB1	1.25e-86	256	212	0.605	0.613	X2JGB1_CYNSE Putative high mobility group B2 protein OS=Cynoglossus semilaevis OX=244447 GN=HMGB2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	1.3e-38	142.5	HMG (high mobility group) box
2	PF09011 HMG_box_2	7.2e-39	143.5	HMG-box domain
3	PF14887 HMG_box_5	91	14.4	HMG (high mobility group) box 5
4	PF06524 NOA36	89	13.9	NOA36 protein
5	PF04147 Nop14	1.7e+02	11.8	Nop14-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008823264.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008833560.1	0.937	Beclin-1 isoform X1
2	1026970.XP_008819683.1	0.890	Advanced glycosylation end product-specific receptor isoform X1
3	1026970.XP_008854009.1	0.888	Tumor protein p53
4	1026970.XP_008831702.1	0.881	Toll-like receptor 4
5	1026970.XP_008852504.1	0.861	Toll like receptor 2
6	1026970.XP_008847121.1	0.847	Lymphocyte antigen 96
7	1026970.XP_008847413.1	0.828	Beclin-2
8	1026970.XP_008844716.1	0.750	Myeloid differentiation primary response 88
9	1026970.XP_008822011.1	0.748	Integrin alpha-M
10	1026970.XP_008845355.1	0.726	High mobility group protein B2
11	1026970.XP_008844419.1	0.717	CREB binding protein
12	1026970.XP_008846986.1	0.709	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
13	1026970.XP_008844594.1	0.685	Interferon regulatory factor 5
14	1026970.XP_008848145.1	0.684	Toll-like receptor 9 isoform X1
15	1026970.XP_008824872.1	0.682	Uncharacterized protein LOC103728687
16	1026970.XP_008831773.1	0.680	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
17	1026970.XP_008835076.1	0.680	Transcription factor AP-1
18	1026970.XP_008849512.1	0.678	Histone H1.0
19	1026970.XP_008846795.1	0.674	Lysine-specific histone demethylase 1A
20	1026970.XP_008831472.1	0.673	Toll-like receptor 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008301	0.995	DNA binding, bending
GO:0005515	0.989	protein binding
GO:0003690	0.989	double-stranded DNA binding
GO:0005102	0.890	signaling receptor binding
GO:0003723	0.873	RNA binding
GO:0008134	0.862	transcription factor binding
GO:0043565	0.810	sequence-specific DNA binding
GO:0140297	0.772	DNA-binding transcription factor binding
GO:0008289	0.762	lipid binding
GO:0003684	0.754	damaged DNA binding
GO:0098772	0.639	molecular function regulator activity
GO:0001786	0.619	phosphatidylserine binding
GO:0140677	0.529	molecular function activator activity
GO:0048018	0.371	receptor ligand activity
GO:0000976	0.321	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050896	0.987	response to stimulus
GO:0050794	0.980	regulation of cellular process
GO:0048518	0.969	positive regulation of biological process
GO:0019222	0.969	regulation of metabolic process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0009893	0.949	positive regulation of metabolic process
GO:0071840	0.900	cellular component organization or biogenesis
GO:0016043	0.893	cellular component organization
GO:0048522	0.882	positive regulation of cellular process
GO:0080090	0.846	regulation of primary metabolic process
GO:0051171	0.840	regulation of nitrogen compound metabolic process
GO:0031323	0.839	regulation of cellular metabolic process
GO:0051716	0.810	cellular response to stimulus
GO:0010604	0.801	positive regulation of macromolecule metabolic process
GO:0010468	0.743	regulation of gene expression
GO:0006950	0.712	response to stress
GO:0019219	0.665	regulation of nucleobase-containing compound metabolic process
GO:0032501	0.638	multicellular organismal process
GO:0048583	0.598	regulation of response to stimulus
GO:0008152	0.595	metabolic process
GO:0048519	0.588	negative regulation of biological process
GO:0071704	0.578	organic substance metabolic process
GO:0044238	0.574	primary metabolic process
GO:0051173	0.572	positive regulation of nitrogen compound metabolic process
GO:0044237	0.568	cellular metabolic process
GO:0032502	0.546	developmental process
GO:0048856	0.544	anatomical structure development
GO:0031325	0.541	positive regulation of cellular metabolic process
GO:0009889	0.533	regulation of biosynthetic process
GO:0010556	0.524	regulation of macromolecule biosynthetic process
GO:0006807	0.520	nitrogen compound metabolic process
GO:0031326	0.515	regulation of cellular biosynthetic process
GO:0007154	0.481	cell communication
GO:0043170	0.478	macromolecule metabolic process
GO:0051252	0.472	regulation of RNA metabolic process
GO:0042221	0.454	response to chemical
GO:0048523	0.453	negative regulation of cellular process
GO:0009605	0.444	response to external stimulus
GO:0051239	0.439	regulation of multicellular organismal process
GO:2001141	0.435	regulation of RNA biosynthetic process
GO:0006355	0.433	regulation of DNA-templated transcription
GO:0002376	0.428	immune system process
GO:0065009	0.427	regulation of molecular function
GO:0045935	0.427	positive regulation of nucleobase-containing compound metabolic process
GO:0048584	0.426	positive regulation of response to stimulus
GO:0023052	0.423	signaling
GO:0023051	0.416	regulation of signaling
GO:0010646	0.416	regulation of cell communication
GO:0009966	0.412	regulation of signal transduction
GO:0009892	0.409	negative regulation of metabolic process
GO:0007165	0.408	signal transduction
GO:0001817	0.403	regulation of cytokine production
GO:0010605	0.402	negative regulation of macromolecule metabolic process
GO:0002682	0.395	regulation of immune system process
GO:0010033	0.394	response to organic substance
GO:0070887	0.389	cellular response to chemical stimulus
GO:0044419	0.383	biological process involved in interspecies interaction between organisms
GO:0031328	0.378	positive regulation of cellular biosynthetic process
GO:0032103	0.376	positive regulation of response to external stimulus
GO:0044093	0.360	positive regulation of molecular function
GO:0010628	0.356	positive regulation of gene expression
GO:0010557	0.356	positive regulation of macromolecule biosynthetic process
GO:0002684	0.352	positive regulation of immune system process
GO:0001819	0.349	positive regulation of cytokine production
GO:0080134	0.337	regulation of response to stress
GO:0031347	0.329	regulation of defense response
GO:0051172	0.329	negative regulation of nitrogen compound metabolic process
GO:0045893	0.327	positive regulation of DNA-templated transcription
GO:0006952	0.326	defense response
GO:0009967	0.323	positive regulation of signal transduction
GO:0006357	0.323	regulation of transcription by RNA polymerase II
GO:0007275	0.313	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005576	0.987	extracellular region
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0005634	0.962	nucleus
GO:0005737	0.956	cytoplasm
GO:0070013	0.947	intracellular organelle lumen
GO:0031981	0.921	nuclear lumen
GO:0005654	0.882	nucleoplasm
GO:0005615	0.865	extracellular space
GO:0005694	0.794	chromosome
GO:0016020	0.745	membrane
GO:0000785	0.464	chromatin
GO:0071944	0.427	cell periphery
GO:0005886	0.398	plasma membrane
GO:0032991	0.386	protein-containing complex
GO:0005829	0.311	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]